Recombinant Pig Membrane cofactor protein (CD46)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Membrane Cofactor Protein (CD46)

Recombinant pig membrane cofactor protein (CD46), also known as membrane cofactor protein (MCP), is a genetically engineered variant of the endogenous porcine CD46 protein. This glycoprotein serves as a critical regulator of the complement system, protecting host cells from autologous complement-mediated lysis by acting as a cofactor for factor I-mediated cleavage of C3b and C4b . Recombinant CD46 is produced via heterologous expression systems (e.g., E. coli) and retains structural and functional properties of the native protein, including its four complement control protein (CCP) modules and glycosylation patterns . Its applications span basic research, vaccine development, and pathogen entry studies, particularly for porcine pestiviruses like APPV and CSFV .

Domain Architecture

Pig CD46 shares structural similarities with human CD46, featuring:

  • Four CCP modules (CCP1–CCP4), which mediate binding to C3b/C4b and pathogen receptors .

  • Serine/threonine/proline-rich (STP) domains, responsible for alternative splicing and isoform diversity .

  • Transmembrane and cytoplasmic tails, involved in membrane anchoring and intracellular signaling .

FeatureDescription
CCP ModulesCCP3 and CCP4 bind pathogens (e.g., S. pyogenes M protein, APPV) .
IsoformsAlternative splicing generates variants with distinct cytoplasmic tails .
GlycosylationO-linked glycans in STP domains influence pathogen recognition .

Expression Patterns

Pig CD46 is ubiquitously expressed on nucleated cells, including erythrocytes (unlike human CD46), endothelial cells, and immune cells . This broad distribution underscores its role in complement regulation and pathogen interaction.

Viral and Bacterial Receptors

Pig CD46 acts as a receptor for multiple pathogens, including:

  • Porcine pestiviruses: APPV, CSFV, and BuPV .

  • Bacteria: Streptococcus pyogenes (via M protein binding to CCP3/CCP4) .

PathogenInteraction SiteFunctional Impact
APPV (Porcine pestivirus)CCP1 domainCritical for viral entry .
CSFVCD46 surface expressionFacilitates infection in PK15/SPEV cell lines .
S. pyogenesCCP3/CCP4Induces apoptosis and immunosuppression .

Mechanistic Insights

  • Viral Entry: CD46 knockout (ΔCD46) cell lines (e.g., SPEVΔCD46, PK15ΔCD46) show complete loss of APPV infectivity, confirming its essential role .

  • Pathogen Shedding: S. pyogenes M protein binding triggers CD46 shedding, promoting bacterial adhesion and host cell death .

Knockout Models

CRISPR/Cas9-engineered ΔCD46 pig cell lines (e.g., SPEVΔCD46 clones 2/7, PK15ΔCD46) enable precise analysis of CD46’s role in pestivirus entry .

Cell LineGenetic AlterationPhenotype
SPEVΔCD46 Clone 2Deletion in CCP1/CCP2 (289 nt)Loss of CD46 surface expression .
PK15ΔCD46 Clone 2Frameshift in CCP1 (stop codon)Resistant to APPV infection .

PCR and Sequencing

Key primers used to validate CD46 knockout or pestivirus RNA include:

PrimerSequence (5′→3′)Target
gCD46-2fwCACCGCGCATGCTTTCAAACTTCGGCCP1 (CRISPR guide RNA) .
1114fwGGTCTATAAGTATCCGGGAGAPPV E^rns

Recombinant CD46 Production

  • Expression System: E. coli (e.g., BL21(DE3)) with N-terminal His tags for purification .

  • Purity: >90% via SDS-PAGE; molecular weight ~35.4 kDa (extracellular domain) .

ParameterValue
Expression RangeAmino acids 36–316 (extracellular domain)
Storage BufferTris/PBS with 5–50% glycerol .

Functional Validation

Recombinant CD46 retains cofactor activity for factor I and binds pathogens in vitro, making it valuable for structural studies or therapeutic development .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
CD46; MCP; Membrane cofactor protein; CD antigen CD46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-363
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
CDEPPKFESMRPQFLNTTYRPGDRVEYECRPGFQPMVPALPTFSVCQDDNTWSPLQEACRRKACSNLPDPLNGQVSYPNGDMLFGSKAQFTCNTGFYIIGAETVYCQVSGNVMAWSEPSPLCEKILCKPPGEIPNGKYTNSHKDVFEYNEVVTYSCLSSTGPDEFSLVGESSLFCIGKDEWSSDPPECKVVKCPYPVVPNGEIVSGFGSKFYYKAEVVFKCNAGFTLHGRDTIVCGANSTWEPEMPQCIKDSKPTDPPATPGPSHPGPPSPSDASPPKDAESLDGGIIAAIVVGVLAAIAVIAGGVYFFHHKYNKKRSK
Uniprot No.

Target Background

Function
Membrane cofactor protein (CD46) acts as a cofactor for complement factor I, a serine protease that protects autologous cells from complement-mediated injury by cleaving C3b and C4b deposited on host tissue. CD46 may be involved in the fusion of spermatozoa with the oocyte during fertilization. It may also act as a costimulatory factor for T-cells, inducing the differentiation of CD4+ into T-regulatory 1 cells. These T-regulatory 1 cells suppress immune responses by secreting interleukin-10, suggesting a role in preventing autoimmunity.
Gene References Into Functions
  1. This study revealed that both porcine CD46 and heparan sulfates play a crucial role in the initial stages of classical swine fever virus infection. PMID: 25559665
Database Links

KEGG: ssc:396922

UniGene: Ssc.14518

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein.
Tissue Specificity
Broadly expressed. Expressed on erythrocytes, leukocytes, granulocytes, platelets, vascular endothelial cells and kidney epithelial cells. Not or weakly expressed in muscle cells and skin (at protein level).

Q&A

What is pig Membrane cofactor protein (CD46) and what are its key functions?

Membrane cofactor protein (MCP), also known as CD46, is a 50-60 kDa glycoprotein that plays a crucial role in regulating complement activation. In pigs, as in humans, CD46 functions primarily as a protective mechanism against complement-mediated damage to autologous tissues . The protein serves as a cofactor for factor I-mediated cleavage of C3b and C4b, effectively regulating both the classical and alternative pathways of complement activation .

Pig CD46 demonstrates cofactor activity for factor I-mediated cleavage of C3b when these components are derived from either pig or human sources. This cross-species functionality makes it an efficient regulator of both human and pig complement systems . Additionally, CD46 has been identified as a receptor for several pathogens, including measles virus, which can lead to its downregulation after viral interaction .

In reproductive biology, CD46 may be involved in the fusion of spermatozoa with the oocyte during fertilization, suggesting its importance beyond complement regulation .

How does pig CD46 distribution differ from human CD46?

Cell/Tissue TypePig CD46 ExpressionHuman CD46 Expression
ErythrocytesHighly expressedAbsent
Other circulating cellsHighly expressedPresent
Most nucleated cellsPresentPresent

Unlike human CD46, which is absent on erythrocytes, pig CD46 is highly expressed on all circulating cells, including erythrocytes . This broader distribution pattern may reflect differences in the evolutionary adaptation of complement regulation between species and could have implications for researchers using pig models for human disease or xenotransplantation studies.

What methods are used to identify and characterize recombinant pig CD46?

Identification and characterization of recombinant pig CD46 typically employ multiple complementary techniques:

  • SDS-PAGE Analysis: Used to confirm the molecular weight and purity of the recombinant protein. Recombinant pig CD46 typically appears as a 50-60 kDa band, with purity standards often set at >90% .

  • Western Blotting: Essential for specific detection of CD46 using antibodies against CD46 or associated tags (e.g., His-tag) .

  • Flow Cytometry (FACS): Used to analyze cell surface expression of CD46 on various cell types and to assess changes in expression levels under different experimental conditions .

  • Functional Assays: The cofactor activity of CD46 can be assessed by measuring its ability to facilitate factor I-mediated cleavage of C3b and C4b. This is typically analyzed through Western blotting to detect the cleavage products (C4d, C4c, iC3b) .

  • Immunohistochemistry: Used to determine the tissue distribution of CD46 expression in transgenic animals and to compare expression patterns with endogenous CD46 .

For recombinant production, E. coli expression systems are commonly employed, with purification facilitated by affinity tags such as N-terminal 6xHis-tags .

What are the methodological considerations for generating transgenic pigs expressing human CD46?

Generating transgenic pigs that express human CD46 involves several methodological considerations for successful implementation:

  • Construct Design: Using large genomic constructs that encompass the entire human CD46 gene has proven more successful than cDNA-based approaches. This approach allows for cell and tissue type-specific expression patterns that resemble endogenous CD46 expression in human tissues .

  • Expression Pattern Analysis: It is critical to verify that the transgenic expression pattern mimics the natural human expression pattern. This can be assessed through comprehensive tissue surveys using immunohistochemistry and flow cytometry .

  • Functional Validation: Transgenic expression must be validated through functional assays that demonstrate the ability of human CD46 to regulate complement activation in the pig cellular environment. This typically involves assessing protection against complement-mediated lysis .

  • Quantitative Expression Level Assessment: The level of expression is crucial for effective complement regulation. Too low expression may not provide sufficient protection, while overexpression may have unintended consequences .

  • Co-expression Strategies: Some research indicates that co-expression of multiple human complement regulatory proteins (CD46, CD55, CD59) may provide more comprehensive protection against xenograft rejection than expression of a single regulator .

Previous studies have demonstrated that transgenic pigs expressing human CD46 show extended xenograft survival when organs are transplanted into baboons (up to 23 days compared to 90 minutes for non-transgenic grafts), providing proof of concept for this approach .

How can researchers evaluate the efficacy of CD46 in preventing complement-mediated damage?

Evaluating the efficacy of CD46 in preventing complement-mediated damage involves multiple experimental approaches:

  • Ex Vivo Perfusion Models: Human-to-pig xenoperfusion systems using whole heparinized human blood can be used to assess complement activation and regulation. Tissue biopsies can be analyzed for deposition of complement components, immunoglobulins, and markers of coagulation .

  • Complement Activation Time Course Studies: Time-dependent analyses reveal that following antibody and complement exposure on CD46+ cells, C4b is progressively cleaved over the first hour to C4d and C4c. No detectable cleavage occurs on CD46- cells, indicating that CD46 (rather than fluid-phase regulators) is the primary mediator of this cofactor activity .

  • Pathway-Specific Assays: Different pathways of complement activation can be selectively tested:

    • Classical pathway: Using antibody sensitization and normal serum

    • Alternative pathway: Using Mg²⁺-EGTA to block the classical pathway

    • Studies show that for the classical pathway, CD46 functions as the cofactor for C4b cleavage while factor H serves as the cofactor for C3b cleavage

  • Quantitative Metrics: Researchers can measure plasma levels of complement activation products and regulators:

    • PAI-1/tPA complexes

    • D-dimers

    • Prothrombin fragment F1+2

  • Function-Blocking Antibody Studies: Using function-blocking monoclonal antibodies against specific complement regulators helps to establish the relative contribution of different factors to complement regulation .

What is the role of CD46 in pathogen interaction, and how does this impact xenotransplantation research?

CD46 serves as a receptor for multiple human pathogens, which has significant implications for xenotransplantation research:

  • Viral Receptors: CD46 has been identified as a receptor for several viruses, including measles virus (MV), human herpesvirus 6, and adenoviruses of different serotypes . This pathogen interaction can lead to downregulation of CD46 from the cell surface following infection .

  • Cross-Species Infection Potential: Studies on CD46-transgenic pig peripheral blood mononuclear cells (PBMCs) revealed unexpected findings regarding measles virus susceptibility:

    • MV vaccine strains (e.g., Edmonston) bound to both transgenic and non-transgenic pig PBMCs

    • Phytohemagglutinin-stimulated pig PBMCs were infected with MV vaccine strains regardless of CD46 expression

    • Transgenic CD46 was downregulated from the cell surface upon infection

    • Wild-type MV strains showed low binding capacity to both pig and human PBMCs

  • Endogenous Pig CD46 Interactions: Expression of endogenous pig CD46 was detected with polyclonal sera against human CD46, and this endogenous protein was also downregulated after infection with MV strain Edmonston. This suggests an interaction between the virus and pig CD46, though antibody inhibition studies indicate that CD46 may not be the exclusive receptor .

  • Implications for Xenotransplantation:

    • Potential for viral infection of transgenic organs expressing human CD46

    • Possible downregulation of protective CD46 following viral exposure, potentially diminishing protection against complement-mediated damage

    • Need for comprehensive viral screening and monitoring in xenotransplantation applications

These findings underscore the complex interplay between complement regulation and pathogen interactions that must be considered in xenotransplantation research using CD46-transgenic pigs.

How does CD46 interact with coagulation and fibrinolysis cascades in xenotransplantation?

The interaction between CD46 and the coagulation/fibrinolysis cascades represents an important consideration in xenotransplantation research:

  • Complement-Coagulation Cross-Talk: Complement inhibition mediated by transgenic expression of human CD46 in pigs may regulate not only complement activation but also the coagulation and fibrinolysis cascades .

  • Assessment Methodologies: Ex vivo xenoperfusion models using human blood perfused through pig forelimbs (both wild-type and hCD46/HLA-E double transgenic) can be used to study these interactions. Key analyses include:

    • Immunohistochemical staining for coagulation markers: fibrin, tissue factor, fibrinogen-like protein 2

    • Assessment of fibrinolysis markers: tissue plasminogen activator (tPA), plasminogen activator inhibitor (PAI)-1

    • Measurement of plasma markers: PAI-1/tPA complexes, D-dimers, prothrombin fragment F1+2

  • Inflammatory Response Connection: Dysregulation of the coagulation system due to inflammatory responses and cross-species molecular incompatibilities represents a major obstacle to successful xenotransplantation. CD46 expression may modulate this inflammatory response, thereby indirectly affecting coagulation .

  • Multi-Transgenic Approaches: The development of multi-transgenic pigs expressing not only complement regulators but also coagulation modulators may provide more comprehensive protection against xenograft rejection and thrombotic microangiopathy .

Understanding these complex interactions is critical for developing effective strategies to overcome coagulation disorders in xenotransplantation, which remain a significant barrier even after hyperacute rejection has been addressed.

What are the amino acid sequence considerations when working with recombinant pig CD46?

When working with recombinant pig CD46, several amino acid sequence considerations are critical for successful experimental design and interpretation:

  • Protein Domains and Functional Regions: The amino acid sequence of CD46 contains several functional domains that are crucial for its complement regulatory activity. Based on homology with human CD46, researchers should identify and preserve:

    • Short consensus repeat (SCR) domains responsible for binding C3b and C4b

    • Serine/threonine/proline-rich domain

    • Transmembrane domain

    • Cytoplasmic tail

  • Expression of Extracellular Domain: For many research applications, expressing the extracellular domain (ECD) is sufficient and more feasible than the full-length protein. As observed in recombinant guinea pig CD46, the ECD typically encompasses amino acids 36-316 .

  • Sequence Analysis for Post-Translational Modifications: The amino acid sequence should be analyzed for potential sites of:

    • N-linked and O-linked glycosylation

    • Disulfide bond formation

    • Protein processing sites

    These modifications can significantly impact protein folding, stability, and function .

  • Species-Specific Variations: Comparing pig CD46 sequence with human CD46 can provide insights into species-specific variations that might affect cross-species complement regulation and pathogen binding. This is particularly important for xenotransplantation applications .

  • Tag Selection and Placement: For recombinant expression, the position of affinity tags (e.g., N-terminal 6xHis-tag) should be carefully considered to minimize interference with protein folding and function .

The amino acid sequence of CD46 can be analyzed using bioinformatics tools to predict structural features and functional domains, guiding experimental design for both basic research and applied studies in xenotransplantation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.