Recombinant Pig Membrane progestin receptor beta (PAQR8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimations, please contact your local distributors.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation whenever possible.
Synonyms
PAQR8; MPRB; Membrane progestin receptor beta; mPR beta; Progestin and adipoQ receptor family member VIII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
PAQR8
Target Protein Sequence
MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTLPLLLYVLSSI TYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFL PAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLAFILDISPVAHRVALCHLSGC QEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI LLDYKGRQEIFLHRHSPLSIYAACLSFFFLVACSGATAALLREKIKARLSKKDS
Uniprot No.

Target Background

Function
Steroid membrane receptor. Binds progesterone. Potentially involved in oocyte maturation.
Database Links
Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of PAQR8 protein?

PAQR8 (mPRβ) is predicted to be a 7-transmembrane protein with an extracellular N-terminus and intracellular C-terminus resembling G-protein-coupled receptors (GPCRs). The protein contains three conserved motifs that resemble those found in the alkaline ceramidase family, suggesting potential enzymatic functionality. The membrane-bound nature of PAQR8 requires specialized techniques for study, as it localizes to cellular membranes rather than functioning as a soluble protein .

What is the molecular weight of recombinant pig PAQR8?

The expected molecular weight of PAQR8 protein is approximately 41 kDa, as confirmed by Western blot analysis using specific antibodies. This can be verified through SDS-PAGE analysis of protein extracts from tissues expressing PAQR8 or from cell lines transfected with PAQR8 expression constructs. When conducting Western blot validation, it is essential to include positive control samples from tissues known to express PAQR8, such as reproductive or neuronal tissues .

In which tissues is PAQR8 predominantly expressed?

PAQR8 expression has been detected in a variety of cell types and tissues. In mammals, it is expressed in normal and malignant breast tissue, ovarian tissue, and myometrial cells. In fish models like Boleophthalmus sinensis, PAQR8 is expressed in the olfactory epithelium, particularly in the dendritic knobs at the apical surface, as well as in testicular tissue. For comprehensive tissue expression profiling, quantitative PCR and immunohistochemistry should be performed across multiple tissue types, with special attention to reproductive and neural tissues .

What are the most effective antibodies for detecting pig PAQR8 in experimental settings?

For specific detection of pig PAQR8, custom polyclonal antibodies can be generated against synthetic peptides derived from the N-terminal region of the protein. Research has successfully used a 15-oligo peptide sequence (MPGDILQRLTTLTL) linked to keyhole limpet hemocyanin (KLH) as an immunogen. After multiple intradermal injections in adjuvant, the resulting antibodies should be verified for specificity by Western blot analysis using both transfected cells expressing PAQR8 and tissue samples known to express the protein endogenously (such as olfactory rosette and testes). Commercial antibodies should be validated using similar approaches before use in critical experiments .

What is the optimal protocol for Western blot detection of PAQR8?

For optimal Western blot detection of PAQR8:

  • Extract total protein by immediately placing freshly excised tissues or cells into 2× SDS buffer

  • Denature proteins by boiling for 5 minutes, then cool on ice

  • Separate proteins using 12% SDS-PAGE gel

  • Transfer proteins onto a PVDF membrane

  • Block in TBST containing 0.1% (v/v) Tween-20 and 5% (w/v) defatted milk powder for 1 hour at room temperature

  • Incubate with validated PAQR8 antibody (1:1000 dilution) for 12 hours at 4°C

  • Wash five times with TBST

  • Incubate with HRP-conjugated secondary antibody (1:1000 dilution) for 1 hour at room temperature

  • Detect signals using a chemiluminescence detection kit

When optimizing this protocol, consider adjusting antibody concentrations and incubation times based on signal strength and background levels .

How can immunohistochemistry be used to localize PAQR8 in tissue samples?

For immunohistochemical localization of PAQR8:

  • Fix tissue samples appropriately (typically with paraformaldehyde)

  • Embed and section tissues according to standard protocols

  • Perform antigen retrieval if necessary

  • Block non-specific binding using appropriate blocking buffer

  • Incubate with primary PAQR8 antibody at optimized dilution

  • Wash and apply fluorescently-labeled secondary antibody

  • Counterstain nuclei if desired

  • Mount and image using confocal microscopy

For co-localization studies, such as detecting PAQR8 and phosphorylated ERK (pERK) in the same cells, use antibodies raised in different species and appropriate species-specific secondary antibodies with distinct fluorophores. Include proper negative controls by omitting primary antibodies to verify the absence of non-specific staining, particularly in regions where PAQR8 is expected to be expressed, such as dendritic knobs in the apical surface of olfactory epithelium .

What is the significance of PAQR8 copy number gain in breast cancer recurrence?

PAQR8 copy number (CN) gain is one of only four focal CN alterations that preferentially occur in recurrent metastatic breast tumors compared to primary tumors. Research has shown that PAQR8 CN gain is associated with:

Notably, in patients treated with anti-estrogen therapies, PAQR8 CN gain is mutually exclusive with activating ESR1 mutations and PGR mutations, suggesting that PAQR8 may provide an alternative mechanism of therapy resistance. When investigating PAQR8 in breast cancer samples, researchers should analyze both primary and recurrent/metastatic samples from the same patients to track changes in PAQR8 status during disease progression .

How can PAQR8's role in therapy resistance be experimentally validated?

To validate PAQR8's role in therapy resistance:

  • Perform cell viability assays with PAQR8-overexpressing and PAQR8-knockout/knockdown cancer cell lines treated with various therapeutic agents (anti-estrogens, chemotherapy, anti-HER2 agents)

  • Assess colony formation efficiency in the presence of therapy

  • Conduct relative cell fitness assays to measure competitive growth advantage

  • Quantify cell survival and proliferation using immunofluorescence staining for markers of apoptosis and proliferation

  • Establish orthotopic mouse models with PAQR8-modified cancer cells to assess tumor recurrence following therapy in vivo

  • Measure changes in downstream signaling pathways (cAMP levels, ceramide metabolism) in response to PAQR8 modulation

  • Analyze patient-derived xenograft models with varying PAQR8 expression levels for response to standard-of-care therapies

These approaches can help determine whether PAQR8 is necessary and sufficient for therapy resistance and recurrence, and can identify the mechanisms involved .

What patient data correlates with PAQR8 alterations in breast cancer?

Analysis of patient data from cohorts like METAMORPH and TCGA shows several important correlations with PAQR8 alterations:

When analyzing patient data, it's important to stratify by treatment history, breast cancer subtype, and disease stage. Note that the impact of PAQR8 CN gain on survival outcomes is comparable to that of ESR1 activating mutations, suggesting a similarly important role in disease progression .

How can CRISPR/Cas9 be optimized for studying PAQR8 function?

For CRISPR/Cas9 modification of PAQR8:

  • Design multiple sgRNAs targeting different exons of PAQR8, focusing on conserved domains and regions encoding transmembrane segments

  • Screen sgRNAs for efficiency using T7 endonuclease assays or next-generation sequencing

  • For knockout studies, target early exons to ensure complete protein loss

  • For knock-in studies (e.g., fluorescent tags, point mutations), design appropriate homology-directed repair templates

  • Validate edits by sequencing and confirm protein alterations by Western blot

  • Establish single cell-derived clones to ensure homogeneity

  • Perform rescue experiments by reintroducing wild-type or mutant PAQR8 to confirm phenotype specificity

  • For regulatory studies, consider CRISPR interference or activation approaches targeting the PAQR8 promoter

When interpreting CRISPR-based studies, consider potential off-target effects and compensatory mechanisms that may arise during clonal selection .

What are the most informative experimental models for studying PAQR8 in therapy resistance?

Several experimental models offer complementary insights into PAQR8's role in therapy resistance:

  • In vitro cell line models:

    • Isogenic cell lines with PAQR8 overexpression or knockout

    • 3D organoid cultures that better recapitulate tissue architecture

    • Co-culture systems with stromal cells to assess microenvironment interactions

  • In vivo models:

    • Orthotopic mouse models with modified PAQR8 expression

    • Patient-derived xenografts with varying PAQR8 levels

    • Genetically engineered mouse models with inducible PAQR8 expression

  • Clinical samples:

    • Paired primary and recurrent tumor samples from the same patients

    • Longitudinal liquid biopsy samples to track PAQR8 CN changes during treatment

The most comprehensive approach combines multiple models, validating findings across systems. For example, cellular phenotypes observed in vitro should be confirmed in orthotopic models, and molecular mechanisms should be verified in patient samples .

What genomic analysis approaches best identify PAQR8 alterations in patient samples?

For comprehensive genomic analysis of PAQR8 alterations:

  • Copy number analysis:

    • Shallow whole genome sequencing for broad CNV detection

    • GISTIC2 algorithm for identification of significant copy number alterations

    • Droplet digital PCR for targeted validation of PAQR8 copy number changes

  • Mutational analysis:

    • Whole exome sequencing to detect potential PAQR8 mutations

    • Targeted deep sequencing of PAQR8 for higher sensitivity

    • RNA-seq to identify fusion events or expression changes

  • Integration with clinical data:

    • Cox proportional hazards regression to associate PAQR8 alterations with survival

    • Multivariate analysis to control for confounding factors

    • Analysis of mutual exclusivity with other alterations (e.g., ESR1 mutations)

When analyzing genomic data, ensure adequate sequencing depth for reliable CNV calling (typically >30x for WGS), and use paired normal samples when possible to distinguish somatic from germline alterations .

How does PAQR8 interact with G-protein signaling pathways?

PAQR8 has been proposed to function similarly to G-protein coupled receptors (GPCRs), potentially coupling to inhibitory G (Gi) proteins. This interaction can be investigated through:

  • Measurement of intracellular cAMP levels in cells with modulated PAQR8 expression

  • Pertussis toxin (PTX) sensitivity assays to confirm Gi protein involvement

  • Co-immunoprecipitation studies to detect physical interaction between PAQR8 and Gi proteins

  • FRET or BRET assays to monitor real-time protein interactions

  • Functional studies comparing wild-type PAQR8 with mutants designed to disrupt G-protein coupling

What is the relationship between PAQR8 and ceramide metabolism?

PAQR8 contains three motifs that resemble those in the alkaline ceramidase family, suggesting it may possess ceramidase activity. To investigate this relationship:

  • Measure ceramide levels in cells with varying PAQR8 expression using liquid chromatography-high resolution mass spectrometry

  • Analyze the levels of other sphingolipids, particularly sphingosine-1-phosphate

  • Perform in vitro ceramidase activity assays with purified PAQR8 protein

  • Test the effects of ceramide pathway inhibitors on PAQR8-mediated phenotypes

  • Generate PAQR8 mutants with alterations in the putative ceramidase motifs and assess their function

Research indicates that PAQR8 may decrease ceramide levels while increasing sphingosine-1-phosphate levels, shifting the balance toward pro-survival signaling. This alteration in sphingolipid metabolism may represent a novel mechanism through which PAQR8 promotes resistance to therapy in cancer cells .

Is progesterone binding necessary for PAQR8 function in different cellular contexts?

The role of progesterone in PAQR8 function remains controversial. To address this question:

  • Conduct competitive binding assays with radiolabeled progesterone

  • Perform functional assays in the presence and absence of progesterone

  • Compare the effects of PAQR8 knockdown on progesterone-mediated and progesterone-independent functions

  • Identify potential progesterone binding sites through mutagenesis of conserved residues

  • Use molecular dynamics simulations to model progesterone interactions with PAQR8

Current evidence suggests that while siRNA knockdown of PAQR8 has been reported to reduce membrane progesterone binding, it did not affect progesterone-mediated downstream functions in some studies. In certain experimental systems, PAQR8 activity has been observed independent of progesterone, suggesting that PAQR8 may have both progesterone-dependent and progesterone-independent functions depending on the cellular context. Researchers should carefully design experiments to distinguish these possibilities when studying PAQR8 function .

How can PAQR8 be targeted therapeutically in cancer?

Based on PAQR8's role in therapy resistance and recurrence, several therapeutic strategies can be explored:

  • Development of small molecule inhibitors targeting:

    • PAQR8's potential ceramidase activity

    • The PAQR8-Gi protein interaction

    • Downstream signaling pathways (cAMP, sphingolipid metabolism)

  • Combination therapy approaches:

    • PAQR8 inhibition plus standard-of-care therapies

    • Targeting parallel resistance mechanisms

    • Sequential therapy to prevent or delay resistance

  • Patient selection strategies:

    • PAQR8 copy number assessment as a biomarker

    • Identification of PAQR8-dependent tumors through molecular profiling

When designing therapeutic strategies, consider potential compensatory mechanisms and resistance pathways that might emerge following PAQR8 inhibition .

What methodologies are most effective for studying PAQR8 in non-mammalian model systems?

To study PAQR8 in non-mammalian models:

  • Fish models:

    • Generate species-specific antibodies against conserved epitopes

    • Perform immunohistochemistry to identify tissue expression patterns

    • Use double-labeling approaches to identify co-localization with signaling markers like pERK

    • Apply in vivo exposure techniques with relevant ligands (e.g., DHP for fish models)

    • Employ CRISPR/Cas9 for genetic manipulation

  • Yeast models:

    • Express mammalian PAQR8 in yeast lacking endogenous PAQR homologs

    • Assess functional complementation of phenotypes

    • Test progesterone-dependence of PAQR8 activity

    • Investigate ceramidase activity in a simplified cellular environment

These non-mammalian systems offer complementary advantages, including simplified genetics, rapid generation time, and the ability to perform high-throughput screens .

How should researchers interpret contradictory findings about PAQR8 function across different experimental systems?

When faced with contradictory findings about PAQR8 function:

  • Carefully evaluate methodological differences:

    • Species and tissue context

    • Expression levels (endogenous vs. overexpression)

    • Experimental readouts and their sensitivity

    • Presence of cofactors or interacting proteins

  • Consider multiple potential functions:

    • PAQR8 may have different roles in different tissues

    • Functions may be context-dependent (cancer vs. normal cells)

    • Both progesterone-dependent and independent mechanisms may exist

    • G-protein signaling and ceramidase activity could be separate functions

  • Design experiments to directly address contradictions:

    • Side-by-side comparison of different cell types or conditions

    • Rescue experiments with wild-type and mutant variants

    • Domain-specific functional assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.