Recombinant Pig Microsomal glutathione S-transferase 1 (MGST1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Pig MGST1 is a membrane-bound enzyme belonging to the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione Metabolism) superfamily. It is produced recombinantly to study its role in conjugating glutathione to electrophiles and reducing lipid hydroperoxides, thereby protecting cellular membranes from oxidative damage . The pig homolog (UniProt ID: P79382) shares high functional and structural conservation with human MGST1, making it a valuable model for toxicology and enzymology research .

2.1. Primary and Quaternary Structure

  • Amino Acid Sequence: Comprises 155 residues, with a conserved N-terminal domain critical for catalytic activity .
    Sequence:
    ADLTELMKNEVFMAFASYATIVLSKMMFMSTATAFYRLTRKVFANPEDCSSFGKGENAKKYLRTDERVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIAYLTPLPQPNRGLAFFLGYGVTLSMAYRLLKSRLYL .

  • Quaternary Structure: Functions as a homotrimer, with glutathione (GSH) binding at the interface of two subunits .

3.1. Enzymatic Activities

  • Glutathione S-Transferase Activity: Conjugates GSH to hydrophobic electrophiles (e.g., lipid peroxides, xenobiotics) .

  • Peroxidase Activity: Reduces hydrogen peroxide (H₂O₂) and lipid hydroperoxides to less reactive alcohols .

3.2. Biological Functions

  • Detoxification: Neutralizes reactive oxygen species (ROS) and electrophilic toxins in hepatic and retinal tissues .

  • Hematopoiesis Regulation: Essential for embryonic hematopoietic stem cell differentiation, as shown in zebrafish and mouse models .

  • Membrane Protection: Localized to endoplasmic reticulum and mitochondrial membranes to prevent oxidative damage .

SubstrateActivityKm (GSH)
Lipid hydroperoxidesReduction to alcohols0.2–0.5 mM
1-Chloro-2,4-dinitrobenzeneGlutathione conjugation0.1–0.3 mM
Hydrogen peroxide (H₂O₂)Peroxidase-mediated reduction0.05–0.1 mM

4.1. Developmental Necessity

  • Knockout of MGST1 in mice results in embryonic lethality due to impaired hematopoiesis .

  • In zebrafish, MGST1 knockdown reduces differentiated myeloid/lymphoid cells by 50–70% and abolishes hemoglobin synthesis .

4.2. Mechanistic Insights

  • One-Third-of-Sites Reactivity: Only one subunit in the homotrimer is catalytically active at a time, optimizing substrate turnover .

  • Redox Signaling: Modulates HIF1α and NF-κB pathways to regulate hematopoietic stem cell metabolism .

5.1. Toxicology Studies

  • Used to investigate detoxification pathways for environmental toxins (e.g., polycyclic aromatic hydrocarbons) .

  • Assayed for glutathione-dependent metabolism of chemotherapeutic agents .

5.2. Disease Models

  • Age-Related Macular Degeneration (AMD): MGST1 expression declines with age in retinal pigment epithelium, correlating with oxidative damage .

  • Cancer: Overexpression in tumors may confer resistance to oxidative stress and chemotherapy .

Recombinant Production

  • Expression Systems: Produced in E. coli, HEK293, or wheat germ systems with tags (e.g., His, GST) for purification .

  • Storage: Stable at -80°C in Tris-GSH buffer; sensitive to freeze-thaw cycles .

ParameterSpecification
Purity>90% (SDS-PAGE)
Storage Buffer0.79% Tris-HCl, 0.3% glutathione, pH 8.0
Activity Retention>80% after 6 months at -80°C

Future Directions

  • Gene Therapy: Targeting MGST1 to enhance oxidative stress resilience in neurodegenerative diseases .

  • Drug Development: Designing inhibitors to sensitize cancer cells to ROS-inducing therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MGST1; GST12; Microsomal glutathione S-transferase 1; Microsomal GST-1; Microsomal GST-I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-155
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
MGST1
Target Protein Sequence
ADLTELMKNEVFMAFASYATIVLSKMMFMSTATAFYRLTRKVFANPEDCSSFGKGENAKK YLRTDERVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIAY LTPLPQPNRGLAFFLGYGVTLSMAYRLLKSRLYL
Uniprot No.

Target Background

Function
Conjugation of reduced glutathione to a wide range of exogenous and endogenous hydrophobic electrophiles.
Database Links

KEGG: ssc:397567

UniGene: Ssc.51886

Protein Families
MAPEG family
Subcellular Location
Microsome. Mitochondrion outer membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is pig Microsomal glutathione S-transferase 1 (MGST1) and what are its primary functions?

Pig Microsomal glutathione S-transferase 1 (MGST1) is a membrane-bound enzyme that belongs to the MAPEG (Membrane-Associated Proteins in Eicosanoid and Glutathione metabolism) family. The mature protein spans amino acids 2-155 of the full sequence and is typically expressed in microsomal fractions of various tissues, with high expression in the liver and retinal pigment epithelium .

The primary functions of MGST1 include:

  • Reduction of lipid peroxidation in cellular membranes

  • Protection of intracellular membranes from oxidative stress

  • Detoxification of xenobiotics through glutathione conjugation

  • Reduction of synthetic peroxides and oxidized lipids

  • Metabolism of oxidized retinoids

These functions make MGST1 a critical enzyme in cellular defense mechanisms against oxidative damage, particularly in tissues with high metabolic activity or exposure to oxidative stress.

How is recombinant pig MGST1 typically expressed and purified for research use?

Recombinant pig MGST1 is typically expressed using bacterial expression systems, most commonly E. coli. The expression and purification process generally follows these methodological steps:

  • Cloning: The MGST1 gene sequence (amino acids 2-155 of the mature protein) is amplified from pig tissue cDNA libraries using PCR with sequence-specific primers and cloned into an expression vector (commonly pET21a) .

  • Expression construct: The MGST1 sequence is often fused with an N-terminal His-tag to facilitate purification. Restriction sites such as BamHI and SalI are frequently used for insertion into the expression vector .

  • Bacterial transformation: The construct is transformed into an E. coli expression strain.

  • Protein expression: Expression is induced (typically with IPTG for pET systems or tetracycline for T-Rex systems) .

  • Purification: The protein is purified using affinity chromatography, with His-tagged MGST1 being purified on Ni-NTA or similar metal affinity resins.

  • Verification: The purified protein is typically verified by SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity .

This approach yields recombinant pig MGST1 suitable for enzymatic activity assays, structural studies, and functional characterization.

What are the molecular characteristics of pig MGST1 compared to other species?

Pig MGST1 shares significant sequence homology with MGST1 from other mammalian species but has some distinct molecular characteristics:

SpeciesMolecular WeightAmino Acid LengthKey Structural FeaturesEnzymatic Properties
Pig MGST1~17 kDa (mature protein)154 amino acids (mature: 2-155)N-terminal transmembrane domainHigh activity toward lipid hydroperoxides
Human MGST1~17.6 kDa155 amino acidsSimilar membrane topologyComparable catalytic efficiency
Bovine MGST1~17.3 kDa154 amino acidsHigh sequence similarity to pigUsed as model in RPE studies

Pig MGST1, like its counterparts in other species, is a membrane-associated protein with a single transmembrane domain. It forms homotrimers in its native state, with each monomer containing an active site capable of binding glutathione .

The pig liver cytosolic glutathione S-transferases differ from microsomal forms and are categorized into distinct classes: four Alpha-class subunits (24.984-25.228 kDa), six Mu-class subunits (25.039-25.657 kDa), and one Pi-class subunit (23.510 kDa) as characterized by electrospray-ionization mass spectrometry .

What experimental methods are commonly used to measure MGST1 activity?

Several experimental approaches are utilized to measure the enzymatic activity of recombinant pig MGST1:

  • Glutathione peroxidase (GPx) activity assay: Measures the ability of MGST1 to reduce organic hydroperoxides using glutathione as a cofactor. The reaction can be monitored by:

    • Tracking glutathione depletion using Ellman's reagent (DTNB)

    • Coupling with glutathione reductase to measure NADPH oxidation spectrophotometrically

  • Lipid peroxidation assays:

    • C11 BODIPY 581/591 lipid peroxidation probe assay: Measures changes in fluorescence as the probe is oxidized

    • Malondialdehyde (MDA) assay: Quantifies lipid peroxidation products

  • GST conjugation activity:

    • CDNB (1-chloro-2,4-dinitrobenzene) conjugation assay: Measures increase in absorbance at 340 nm as glutathione is conjugated to CDNB

  • ELISA-based detection:

    • Specific ELISA kits are available for pig MGST1 with high sensitivity and specificity

    • Standard deviation <8% for intra-assay precision and <10% for inter-operator variation

  • Mass spectrometry identification:

    • LC-MS/MS for protein identification and characterization

    • Tryptic digestion followed by peptide analysis

These methods provide complementary information about different aspects of MGST1 enzymatic function and expression.

How does MGST1 contribute to cellular defense against oxidative stress?

MGST1 plays a multifaceted role in protecting cells from oxidative damage through several mechanisms:

  • Direct peroxide reduction: MGST1 uses glutathione as a cofactor to reduce hydrogen peroxide and lipid hydroperoxides, thereby preventing their accumulation and subsequent damage to cellular components .

  • Membrane protection: As a membrane-associated enzyme, MGST1 is strategically positioned to protect membrane lipids from peroxidation. Studies with MGST1-transfected HEK293 cells demonstrated significantly higher viability (70 ± 4% survival) compared to control cells (46 ± 4% survival) when challenged with 20μM H₂O₂ .

  • Detoxification of oxidized lipids: MGST1 can reduce oxidized polyunsaturated fatty acids such as docosahexaenoic acid, which is particularly abundant in retinal tissues .

  • Ferroptosis regulation: MGST1 has been implicated in protection against ferroptosis, a form of regulated cell death characterized by iron-dependent lipid peroxidation. Knockdown of MGST1 in gastric cancer cells led to increased susceptibility to oxidative damage .

  • Oxidized retinoid metabolism: In the retinal pigment epithelium, MGST1 contributes to the reduction of oxidized retinoids, which is crucial for maintaining visual function .

Experimental evidence from siRNA knockdown studies in ARPE19 cells showed that reduced MGST1 expression (12% and 26% of control levels) led to significantly lower GPx activity (44 ± 13%) and increased susceptibility to oxidative damage, confirming its protective role .

What are the optimal conditions for maintaining the enzymatic activity of recombinant pig MGST1 in experimental settings?

The enzymatic activity of recombinant pig MGST1 is sensitive to several experimental conditions that researchers should carefully control:

Optimal buffer conditions:

  • pH: 7.0-7.4 (phosphate or Tris-HCl buffers)

  • Ionic strength: 100-150 mM NaCl

  • Reducing agents: 1-5 mM DTT or 2-mercaptoethanol to maintain the reduced state of critical thiol groups

  • Detergents: Low concentrations (0.01-0.05%) of non-ionic detergents like Triton X-100 or n-dodecyl-β-D-maltoside help maintain activity of the membrane-associated enzyme

Storage conditions:

  • Temperature: -80°C for long-term storage; activity decreases significantly at higher temperatures

  • Glycerol: Addition of 10-20% glycerol helps maintain stability during freeze-thaw cycles

  • Avoid repeated freeze-thaw cycles which can lead to >50% loss of activity

Cofactor requirements:

  • Glutathione: Maintain 1-5 mM reduced glutathione in reaction mixtures

  • Avoid oxidized glutathione which can act as a competitive inhibitor

Activity optimization:

  • Substrate concentration: Optimal concentration varies by substrate but typically falls in the 10-100 μM range for lipid hydroperoxides

  • Reaction temperature: 25-37°C, with higher temperatures increasing reaction rates but potentially decreasing stability over time

  • Reaction time: Monitor kinetics within linear range, typically 5-30 minutes depending on enzyme concentration

When using affinity chromatography for purification, glutathione (GSH) has shown better binding selectivity than S-hexylglutathione (ShGSH), although both matrices retain some non-GST proteins .

How does pig MGST1 contribute to ferroptosis regulation, and what experimental approaches best elucidate this role?

MGST1 has emerged as a key regulator of ferroptosis, an iron-dependent form of programmed cell death characterized by accumulation of lipid peroxides. The relationship between MGST1 and ferroptosis can be experimentally investigated through several approaches:

Mechanistic role of MGST1 in ferroptosis:

  • MGST1 functions primarily as an anti-ferroptotic factor by reducing lipid peroxides that otherwise accumulate during ferroptosis

  • High expression of MGST1 correlates with resistance to ferroptosis inducers in cancer cells

  • MGST1 works alongside other glutathione-dependent enzymes like GPX4 to maintain redox homeostasis

Experimental approaches to study MGST1 in ferroptosis:

  • Genetic manipulation:

    • shRNA knockdown of MGST1 in gastric cancer cells demonstrated increased susceptibility to oxidative stress

    • Overexpression systems using tetracycline-inducible expression showed protective effects against oxidative damage

  • Ferroptosis induction and monitoring:

    • Treatment with ferroptosis inducers (erastin, RSL3, sorafenib) in cells with modulated MGST1 expression

    • Monitoring cell viability (CCK-8 assay) and proliferation (EDU assay) as demonstrated in gastric cancer cell studies

  • Lipid peroxidation detection:

    • C11 BODIPY 581/591 probe for real-time monitoring of lipid peroxidation

    • MDA assay to quantify end products of lipid peroxidation

  • Molecular pathway analysis:

    • Western blotting to assess expression of ferroptosis-related proteins

    • Analysis of interactions with Wnt/β-catenin pathway components, as MGST1 knockdown reduced expression of N-cadherin, Slug, Snail, Vimentin, and β-catenin while increasing E-cadherin expression

  • Comparative analysis with other ferroptosis regulators:

    • Co-expression analysis with GPX4, SLC7A11, and other established ferroptosis regulators

    • Comparative vulnerability to different ferroptosis inducers

In gastric cancer research, MGST1 knockdown significantly inhibited cell migration and invasion capabilities as measured by transwell assays, suggesting that beyond its role in ferroptosis, MGST1 may influence cancer progression through additional mechanisms .

What are the key differences in catalytic efficiency between recombinant pig MGST1 and native MGST1 extracted from pig tissues?

Recombinant and native pig MGST1 exhibit several differences in their catalytic properties and experimental performance:

ParameterRecombinant Pig MGST1Native Pig MGST1Methodological Considerations
Specific Activity (μmol/min/mg)Typically 60-80% of native enzymeBenchmark value (100%)Measured using CDNB assay or GPx activity assay
Substrate Affinity (Km)Often slightly higher Km values indicating lower affinityLower Km values for most substratesDetermined by varying substrate concentration in enzyme kinetics studies
Membrane AssociationRequires detergent or reconstitution into liposomes for optimal activityNaturally integrated into microsomal membranesActivity affected by lipid composition and detergent choice
Post-translational ModificationsLacks tissue-specific modificationsContains various modifications including potential phosphorylation sitesMass spectrometry analysis reveals differences
StabilityGenerally more stable during purificationMore sensitive to extraction conditionsThermal stability assays show differences
Glutathione BindingMay show altered binding kineticsNative binding propertiesIsothermal titration calorimetry can measure differences

These differences arise primarily from:

  • Expression system effects: Bacterial expression systems lack the machinery for mammalian post-translational modifications

  • Membrane environment: Native MGST1 exists in a specific microsomal membrane environment that affects its conformation and activity

  • Purification impact: The purification process, especially the use of detergents, can alter the protein's tertiary structure

  • Tag interference: His-tags or other fusion tags may subtly affect enzyme activity or substrate binding

When designing experiments, researchers should consider these differences and select the appropriate form based on specific experimental goals. For structural studies and initial characterization, recombinant protein offers advantages of quantity and purity. For studies focused on physiological activity, native enzyme may provide more relevant results .

How can researchers effectively use MGST1 as a model for studying glutathione transferase mechanisms in xenobiotic metabolism?

MGST1 serves as an excellent model system for understanding glutathione transferase mechanisms in xenobiotic metabolism due to its well-characterized structure and catalytic properties. Researchers can utilize the following methodological approaches:

  • Structure-function relationship studies:

    • Site-directed mutagenesis of key residues in the active site to determine their role in catalysis

    • Comparison of pig MGST1 with other species to identify conserved catalytic residues

    • Crystallographic studies to determine binding modes of substrates and inhibitors

  • Catalytic mechanism investigations:

    • Pre-steady-state kinetics to identify reaction intermediates

    • pH-dependency studies to determine ionization states of catalytic residues

    • Isotope effect measurements to elucidate rate-limiting steps

  • Substrate specificity profiling:

    • Systematic testing of structurally diverse xenobiotics to map the substrate binding pocket

    • Comparison with cytosolic GSTs (Alpha-, Mu-, and Pi-class) that have been characterized in pig liver to understand specialized functions

    • Quantitative structure-activity relationship (QSAR) analysis to correlate chemical properties with catalytic efficiency

  • Membrane association studies:

    • Reconstitution of recombinant MGST1 into liposomes of defined composition

    • Investigation of how membrane composition affects enzyme activity

    • Comparison with soluble GSTs to understand the influence of membrane environment on catalysis

  • Integration with cellular models:

    • Expression of pig MGST1 in cellular models exposed to xenobiotics

    • Metabolite profiling using LC-MS/MS to identify glutathione conjugates

    • Competition experiments with endogenous substrates to assess physiological relevance

The purification of pig liver GSTs has been optimized using affinity chromatography, with glutathione (GSH) showing better binding selectivity than S-hexylglutathione (ShGSH), providing a methodological foundation for obtaining pure enzyme for mechanistic studies .

The characterization of different GST classes in pig liver (Alpha, Mu, and Pi) with distinct molecular masses (Alpha: 24.984-25.228 kDa; Mu: 25.039-25.657 kDa; Pi: 23.510 kDa) offers comparative models for understanding different catalytic mechanisms within the GST superfamily .

What are the current challenges and limitations in studying the structure-function relationship of pig MGST1?

Research on the structure-function relationship of pig MGST1 faces several significant challenges:

  • Membrane protein crystallization difficulties:

    • The hydrophobic nature of MGST1 makes it challenging to crystallize for high-resolution structural studies

    • Detergent selection critically affects protein stability and crystal formation

    • Alternative approaches such as cryo-EM may be required for structural determination

  • Heterologous expression limitations:

    • Expression levels in bacterial systems may be low due to membrane protein toxicity

    • Differences in post-translational modifications between recombinant and native enzyme

    • Proper folding and membrane insertion may not occur efficiently in E. coli

  • Enzymatic assay challenges:

    • Many MGST1 substrates (lipid hydroperoxides) have poor aqueous solubility

    • Detergent requirements for solubilization may interfere with activity measurements

    • Distinguishing MGST1 activity from other glutathione-dependent enzymes in complex samples

  • Physiological substrate uncertainty:

    • The true physiological substrates of MGST1 remain incompletely characterized

    • Artificial substrates used in assays may not reflect native function

    • Complex lipid hydroperoxides are difficult to synthesize and standardize

  • Technical challenges in measuring membrane protection:

    • Quantifying the protective effect of MGST1 against membrane peroxidation requires specialized techniques

    • Creating standardized oxidative stress conditions that mimic physiological stress

    • Isolating the contribution of MGST1 from other antioxidant enzymes

  • Interference from non-GST proteins:

    • Studies have shown that affinity purification using glutathione-based matrices can retain non-GST proteins, including mevalonate kinase and carbonyl reductase, potentially contaminating MGST1 preparations

These challenges necessitate multi-faceted approaches combining biochemical, structural, and cellular techniques to fully elucidate the structure-function relationship of pig MGST1. Researchers must carefully design experiments that account for these limitations and validate findings using complementary methods.

How do post-translational modifications affect the activity and stability of recombinant pig MGST1?

Post-translational modifications (PTMs) significantly impact the functional properties of MGST1, with important implications for researchers working with recombinant versus native forms:

Key PTMs affecting MGST1 properties:

  • Phosphorylation:

    • Potential phosphorylation sites have been identified in MGST1

    • Phosphorylation can modulate enzyme activity by altering protein conformation or substrate binding

    • Recombinant MGST1 from bacterial expression systems lacks these modifications

  • Glutathionylation:

    • Reactive cysteine residues can form mixed disulfides with glutathione

    • This reversible modification affects catalytic activity and can serve as a regulatory mechanism

    • MS/MS analysis can identify glutathionylated residues

  • Membrane lipid interactions:

    • While not a classical PTM, the interaction with specific membrane lipids affects protein conformation

    • Recombinant MGST1 may lack these native lipid interactions

    • Reconstitution with different lipid compositions can partially restore native-like properties

Methodological approaches to study PTM effects:

  • Comparative analysis:

    • Direct activity comparison between recombinant and native enzyme

    • Mass spectrometry to identify and quantify PTMs in native MGST1

    • Site-directed mutagenesis of potential modification sites

  • In vitro modification:

    • Treatment of recombinant MGST1 with kinases to introduce phosphorylation

    • Controlled oxidation or glutathionylation of specific residues

    • Monitoring activity changes after modification

  • Stability assessment:

    • Thermal shift assays to compare melting temperatures of modified and unmodified protein

    • Long-term storage stability at different temperatures

    • Resistance to proteolytic degradation

  • Structural impact:

    • Circular dichroism to detect secondary structure changes

    • Intrinsic fluorescence to monitor tertiary structure alterations

    • Hydrogen-deuterium exchange mass spectrometry to identify regions affected by modifications

Researchers have employed LC-MS/MS techniques to identify MGST1 and characterize its modifications, using established protocols that involve tryptic digestion of gel-separated proteins followed by peptide extraction and analysis on systems such as the Waters QTOF2 mass spectrometer .

What experimental approaches can be used to investigate the role of MGST1 in membrane protection during oxidative stress?

Investigating MGST1's role in membrane protection during oxidative stress requires multifaceted experimental approaches:

  • Cell-based oxidative stress models:

    • MGST1 overexpression and knockdown systems:

      • Tetracycline-inducible MGST1 expression systems in HEK293 cells showed significantly improved survival (70 ± 4%) compared to control cells (46 ± 4%) when challenged with H₂O₂

      • siRNA-mediated MGST1 knockdown in ARPE19 cells demonstrated reduced GPx activity (44 ± 13% of control) and increased oxidative damage susceptibility

    • Oxidative stress induction methods:

      • H₂O₂ treatment (typically 10-50 μM)

      • tert-Butyl hydroperoxide (tBH) exposure

      • Oxidized docosahexaenoic acid challenge

      • Iron overload combined with glutathione depletion

  • Membrane integrity and peroxidation assays:

    • Lipid peroxidation detection:

      • C11 BODIPY 581/591 fluorescent probe: Shifts emission from red to green upon oxidation

      • Malondialdehyde (MDA) assay: Quantifies lipid peroxidation end products

      • 4-hydroxynonenal (4-HNE) immunodetection: Measures specific lipid peroxidation products

    • Membrane integrity assessment:

      • Propidium iodide exclusion assay

      • Lactate dehydrogenase (LDH) release measurement

      • Liposome leakage assays with purified MGST1

  • Localization and functional studies:

    • Subcellular fractionation:

      • Isolation of microsomes and measurement of MGST1 distribution

      • Activity assays in different cellular compartments

    • Live cell imaging:

      • GFP-tagged MGST1 to monitor localization during oxidative stress

      • Co-localization with lipid peroxidation sensors

  • In vitro membrane systems:

    • Liposome-based assays:

      • Reconstitution of MGST1 into liposomes of defined composition

      • Measurement of lipid peroxidation in the presence/absence of MGST1

      • Electron paramagnetic resonance (EPR) with spin-labeled lipids

    • Membrane mimetic systems:

      • Planar lipid bilayers with incorporated MGST1

      • Surface plasmon resonance to measure MGST1-membrane interactions

  • Comparative analysis with other protective systems:

    • Parallel assessment with other antioxidant enzymes:

      • GPx4 as another key anti-ferroptotic enzyme

      • Catalase and superoxide dismutase to distinguish hydrogen peroxide vs. lipid peroxide protection

    • Combined knockdown/inhibition experiments:

      • MGST1 knockdown combined with GPx4 inhibition

      • Assessment of synergistic effects on membrane vulnerability

These approaches provide complementary information about MGST1's protective mechanisms and can be tailored to specific research questions about membrane protection during oxidative stress .

How can researchers effectively design knockdown or overexpression experiments to study MGST1 function in cellular models?

Designing effective genetic manipulation experiments to study MGST1 function requires careful consideration of multiple factors:

Knockdown strategies:

  • RNA interference approaches:

    • shRNA-mediated knockdown:

      • Lentiviral vectors carrying MGST1-specific shRNA have been successfully used to achieve stable knockdown in gastric cancer cell lines (AGS and SGC-7901)

      • Multiple shRNA sequences targeting different regions of MGST1 mRNA should be tested to identify the most effective construct

      • Validation of knockdown efficiency by Western blot showed significant reduction in MGST1 protein levels

    • siRNA-mediated knockdown:

      • Transient knockdown using siRNAs targeting MGST1 has been effective in ARPE19 cells

      • Demonstrated reduction to 12-26% of control MGST1 levels

      • Allows for rapid screening of phenotypes but requires optimization of transfection conditions

  • CRISPR-Cas9 genome editing:

    • Allows for complete knockout rather than knockdown

    • Requires careful guide RNA design specific to pig MGST1 sequence

    • Should include sequencing verification of induced mutations

    • Consider generating heterozygous knockouts if complete loss is lethal

Overexpression strategies:

  • Constitutive overexpression:

    • Standard CMV promoter-driven expression

    • Should include appropriate tags (His, FLAG, etc.) for detection and purification

    • Consider codon optimization for the host cell system

  • Inducible expression systems:

    • Tetracycline-inducible T-Rex system has been successfully used for MGST1 expression

    • Allows for controlled timing and level of expression

    • Crucial for studying proteins that may be toxic when constitutively overexpressed

  • Viral vector delivery:

    • Adenoviral or lentiviral systems provide high transduction efficiency

    • Appropriate for difficult-to-transfect cell types

Experimental design considerations:

  • Control constructs:

    • Empty vector controls for overexpression

    • Non-targeting shRNA/siRNA controls for knockdown

    • Include rescue experiments with shRNA-resistant MGST1 constructs

  • Validation methods:

    • Western blot to confirm protein level changes

    • qRT-PCR to measure mRNA levels

    • Enzymatic activity assays to confirm functional impact

  • Phenotypic assays:

    • Cell viability (CCK-8 assay) following oxidative challenge

    • Proliferation assessment (EDU assay)

    • Cell cycle analysis by flow cytometry

    • Migration and invasion capacity (transwell assays)

  • Timeline considerations:

    • Allow sufficient time after transfection/transduction for protein turnover

    • For MGST1 knockdown, 48-72 hours post-transfection typically shows maximal effect

    • For inducible systems, optimize induction time (48 hours of tetracycline treatment has been effective)

In published studies, MGST1 knockdown induced cell cycle arrest in the G1/S phase as measured by flow cytometry, and significantly reduced migration and invasion capabilities in gastric cancer cell lines, demonstrating the effectiveness of these genetic manipulation approaches for studying MGST1 function .

What are the methodological considerations for studying MGST1 interactions with other proteins in the glutathione pathway?

Investigating MGST1's interactions with other proteins in the glutathione pathway requires specialized techniques to capture these often transient or membrane-associated interactions:

Protein-protein interaction identification methods:

  • Co-immunoprecipitation (Co-IP):

    • Requires specific antibodies against pig MGST1

    • Membrane solubilization with mild detergents (0.1-0.5% Triton X-100, n-dodecyl-β-D-maltoside)

    • Western blot detection of co-precipitated proteins

    • Consider crosslinking to stabilize transient interactions

  • Proximity labeling approaches:

    • BioID or APEX2 fusion with MGST1 for proximity-dependent labeling

    • Allows identification of proximal proteins in native membrane environment

    • MS/MS analysis of biotinylated proteins following streptavidin pulldown

    • Particularly valuable for membrane-associated interactions

  • Yeast two-hybrid membrane system:

    • Split-ubiquitin membrane yeast two-hybrid specifically designed for membrane proteins

    • Library screening to identify novel interactors

    • Requires careful design of bait constructs to maintain membrane topology

  • Protein complementation assays:

    • Split fluorescent protein systems (BiFC)

    • Split luciferase assays

    • Allow visualization of interactions in living cells

Functional interaction assessment:

  • Enzymatic coupling assays:

    • Measure sequential activities in glutathione pathway

    • Compare activity with purified components vs. cellular fractions

    • Identify rate-limiting steps and regulatory nodes

  • Competitive and synergistic interaction studies:

    • Examine effects of other pathway enzymes on MGST1 activity

    • Test for substrate channeling between sequential enzymes

    • Measure kinetic parameters in presence/absence of potential interactors

  • Co-expression analysis:

    • siRNA-mediated knockdown of MGST1 followed by proteomics to identify affected proteins

    • qRT-PCR to measure changes in expression of other pathway components

    • Western blot analysis of Wnt/β-catenin pathway components showed that MGST1 knockdown significantly reduced levels of N-cadherin, Slug, Snail, Vimentin, and β-catenin

Considerations for membrane-associated interactions:

  • Detergent selection:

    • Critical for maintaining native interactions while solubilizing membrane proteins

    • Test panel of detergents (digitonin, CHAPS, DDM)

    • Consider detergent-free methods (styrene-maleic acid copolymer)

  • Lipid environment:

    • Reconstitution in liposomes or nanodiscs to maintain native-like environment

    • Inclusion of specific lipids that may mediate protein-protein interactions

  • Membrane topology preservation:

    • Ensure interaction detection methods maintain correct orientation

    • Consider asymmetric reconstitution systems

Data analysis and validation:

  • Control interactions:

    • Include known interactors as positive controls

    • Use unrelated membrane proteins as negative controls

    • Validate novel interactions through multiple independent methods

  • Quantitative interaction analysis:

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for interactions in complex solutions

Researchers have utilized the STRING website to establish protein-protein interaction networks for MGST1, revealing connections with ferroptosis-related proteins and providing a foundation for more detailed interaction studies .

How do different oxidative stress inducers affect MGST1 expression and activity in experimental systems?

The response of MGST1 to various oxidative stress inducers shows distinct patterns that provide insights into its protective mechanisms and regulation:

Common oxidative stress inducers and their effects on MGST1:

Oxidative StressorTypical Concentration RangeEffect on MGST1 ExpressionEffect on MGST1 ActivityCellular ResponseExperimental Considerations
Hydrogen peroxide (H₂O₂)10-100 μMModerate upregulation (1.5-2x)Initial decrease followed by recoveryMGST1-expressing cells show 70±4% survival vs 46±4% in controls Short half-life requires fresh preparation
tert-Butyl hydroperoxide (tBH)5-50 μMStrong upregulation (2-3x)Sustained increaseMore specific for lipid peroxidationMore stable than H₂O₂
Menadione (vitamin K₃)5-25 μMBiphasic responseDecreased at high concentrationsGenerates superoxide and H₂O₂Interacts with thiols directly
Oxidized docosahexaenoic acid5-20 μMStrong upregulationEnhanced activityDirectly tests MGST1's role in lipid repairPreparation variability affects results
Glutathione depletion (BSO)10-100 μMCompensatory upregulationDecreased due to cofactor limitationSensitizes to concurrent oxidative stressPretreatment (12-24h) required
Iron overload (ferric ammonium citrate)50-200 μMModerate upregulationVariable effectsPromotes Fenton chemistry and lipid peroxidationConsider chelation in media
Ferroptosis inducers (erastin, RSL3)Erastin: 1-10 μM; RSL3: 0.1-1 μMComplex regulationCritical for survivalMGST1 knockdown enhances sensitivity Specific for ferroptotic mechanisms

Methodological approaches to study MGST1 under oxidative stress:

  • Expression analysis techniques:

    • qRT-PCR for mRNA quantification

    • Western blot for protein level assessment

    • Reporter gene assays (luciferase) for promoter activity

    • Immunohistochemistry for tissue localization

  • Activity measurement approaches:

    • Glutathione peroxidase activity assays

    • CDNB conjugation assay

    • Specific activity normalization to expression levels

    • In situ activity assays in cell fractions

  • Time-course considerations:

    • Immediate response (0-2 hours): Often reflects post-translational regulation

    • Intermediate response (2-8 hours): Combines post-translational and transcriptional regulation

    • Long-term response (>8 hours): Predominantly transcriptional/translational regulation

  • Compartment-specific analysis:

    • Microsomal fraction isolation to focus on membrane-bound MGST1

    • Subcellular fractionation to track potential redistribution

    • Immunofluorescence microscopy for localization changes

  • Comprehensive oxidative stress profiling:

    • Parallel assessment of multiple antioxidant enzymes

    • Measurement of glutathione levels and redox state

    • Global proteomic and transcriptomic analysis

    • Metabolomic profiling of oxidative stress markers

Studies in gastric cancer cells have shown that MGST1 expression significantly impacts cell survival under oxidative stress conditions, with knockdown cells showing reduced proliferation as measured by CCK-8 and EDU assays . Additionally, MGST1 expression correlates with prognosis in various cancers, with high expression associated with poor survival outcomes, suggesting its important role in oxidative stress response in pathological conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.