Recombinant Pig Mitochondrial uncoupling protein 2 (UCP2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Mitochondrial Uncoupling Protein 2 (UCP2)

Recombinant Pig Mitochondrial Uncoupling Protein 2 (UCP2) is a genetically engineered version of the endogenous protein expressed in pigs (Sus scrofa). UCP2 belongs to the mitochondrial anion carrier family and plays a critical role in regulating proton leak across the inner mitochondrial membrane, thereby modulating energy metabolism, reactive oxygen species (ROS) production, and cellular survival . Recombinant UCP2 is widely used in research to study its structural, functional, and therapeutic roles in metabolic and degenerative diseases.

Protein Composition

  • Primary Structure: Recombinant Pig UCP2 consists of 309 amino acids with a molecular weight of ~33 kDa .

  • Gene Structure: The UCP2 gene in pigs spans 4.2–4.5 kb with 8 exons and 7 introns, conserved across vertebrates .

Expression and Purification

  • Expression System: Produced in E. coli via in vitro expression, ensuring high yield and purity .

  • Storage: Stable at -20°C or -80°C; repeated freeze-thaw cycles are discouraged .

Mitochondrial Regulation

  • Proton Uncoupling: UCP2 facilitates proton leakage, reducing mitochondrial membrane potential (Δψ) and ROS production while dissipating energy as heat .

  • ATP Modulation: By altering proton flux, UCP2 indirectly regulates ATP/ADP ratios, impacting insulin secretion and cellular energy balance .

Antioxidant and Protective Effects

  • ROS Scavenging: UCP2 mitigates oxidative stress by lowering mitochondrial ROS, protecting against ischemia-reperfusion injury and neurodegeneration .

  • Cell Survival: Overexpression of UCP2 prevents mitochondrial permeability transition pore (mPTP) activation, reducing apoptosis in cardiomyocytes and neurons .

Metabolic and Immune Modulation

  • Lipid Metabolism: UCP2 influences fatty acid oxidation and lipid storage, with implications for obesity and diabetes .

  • Immune Regulation: UCP2 suppresses mast cell activation by reducing histamine release and ERK phosphorylation .

Experimental Models

  • Neurodegenerative Studies: UCP2 overexpression protects against MPP⁺-induced toxicity in Parkinson’s disease models by maintaining ATP and mitochondrial membrane potential .

  • Cardiovascular Research: UCP2 attenuates H₂O₂-induced mitochondrial Ca²⁺ overload and ROS in cardiomyocytes, offering cardioprotective insights .

  • Cancer Metabolism: UCP2 silencing alters glucose and glutamine oxidation, highlighting its role in tumor bioenergetics .

Key Findings in Pig-Specific Studies

Study FocusKey OutcomeSource
Gene DeletionsDeletions in UCP2 correlate with altered body weight and metabolic traits in pigs
ROS RegulationUCP2 knockdown increases oxidative stress and necrosis in renal cells
Protein QuantificationRecombinant UCP2 used to standardize tissue-specific expression assays

Clinical and Therapeutic Implications

  • Diabetes: UCP2 modulates β-cell ROS, affecting insulin secretion and glucose homeostasis .

  • Hypertension: UCP2 downregulation exacerbates renal and cerebrovascular damage in hypertensive models .

  • Aging and Cancer: UCP2 induces G₁-phase cell cycle arrest and non-apoptotic death in hepatocytes, suggesting roles in aging and cancer .

Challenges and Future Directions

  • Functional Controversies: While UCP2 is implicated in metabolic uncoupling, recent studies emphasize its role as a metabolite transporter (e.g., exporting C4 compounds like malate) .

  • Therapeutic Targeting: Developing UCP2 agonists/antagonists requires resolving tissue-specific effects and downstream signaling pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
UCP2; SLC25A8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MVGFKATEVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERRGPVQAAASAQYR GVLGTILTMVRNEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKHFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYRSTVDAYKTIAREEGLRGLWKGTS PNVARNAIVNCAELVTYDLIKDTLLKADLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSAPGQYSSAGHCALTMLQKEGPRAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMA ARASREAPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation from ATP synthesis. Consequently, energy is dissipated as heat.
Gene References Into Functions
  1. Despite patent grafts, revascularized hibernating myocardium demonstrates a submaximal response to dobutamine infusion and increased mitochondrial UCP-2 expression. PMID: 25199570
  2. Seven deletion polymorphisms were covered in introns of linkage genes of UCP2 and UCP3, indicating that UCPs exhibit conservation and genetic reliability. PMID: 17221299
  3. In vivo data suggest that beta-adrenergic agonists may play a role in regulating UCP2 and UCP3 expression in specific muscles. PMID: 17383207
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of UCP2 in mitochondria and how does it differ from other UCPs?

UCP2 is an inner mitochondrial membrane protein belonging to the uncoupling protein family. Its primary function involves lowering mitochondrial membrane potential and dissipating metabolic energy, thereby preventing oxidative stress accumulation . Unlike UCP1 (primarily expressed in brown adipose tissue for thermogenesis), UCP2 displays broader tissue distribution and plays crucial roles in ROS regulation across multiple systems.

The mild uncoupling theory explaining UCP2's ROS-regulating function was first identified through experiments demonstrating that UCP2 inhibition causes a rapid increase of H₂O₂ . In Ucp2-/- mice, increased mitochondrial ROS production is observed, which enhances phagocytosis of infectious agents in macrophages .

UCP2 displays approximately 60% sequence identity with UCP1 . The genes encoding UCP2 and UCP3 are adjacent in all species, mapping to mouse chromosome 7, rat chromosome 1, and human chromosome 11 .

What experimental models are most appropriate for studying recombinant pig UCP2 function?

Methodological approach:
When designing experiments with recombinant pig UCP2, researchers should consider:

  • In vitro systems:

    • Reconstituted proteoliposome systems with purified recombinant pig UCP2

    • Isolated mitochondria with incorporated recombinant protein

    • Cell culture models transfected with pig UCP2 expression vectors

  • Knockout/knockdown models:

    • CRISPR-Cas9 mediated UCP2 gene editing in porcine cell lines

    • siRNA approaches in pig-derived cells

  • Comparative models:

    • Parallel experiments with human and pig UCP2 to identify species-specific differences

    • Chimeric proteins to identify functional domains

Experimental readouts should include membrane potential measurements, ROS production assays, oxygen consumption rates, and proton leak assessments to comprehensively characterize UCP2 function .

What are the optimal expression systems and purification strategies for producing functional recombinant pig UCP2?

Methodological guidance:

While the search results don't specifically address pig UCP2 expression systems, researchers should consider these approaches based on membrane protein expression principles:

  • Expression systems selection:

    • E. coli systems: Suitable for high yield but may require refolding

    • Yeast expression: P. pastoris often provides better folding for membrane proteins

    • Insect cell/baculovirus: Preferred for maintaining native structure of mammalian membrane proteins

    • Mammalian expression: HEK293 or CHO cells for authentic post-translational modifications

  • Purification strategies:

    • Extraction using mild detergents (DDM, LMNG) to maintain protein integrity

    • Affinity chromatography with carefully positioned tags that don't interfere with function

    • Size exclusion chromatography to ensure homogeneity

    • Lipid reconstitution to restore native-like environment

  • Functional verification:

    • Proton transport assays in proteoliposomes

    • Patch-clamp electrophysiology

    • Thermal stability assays

    • Binding assays for known regulators

The cloning approach described for creating genetically modified pigs could potentially be adapted for UCP2 expression: "Once you have a live pig that contains the desired genes, cloning can make many copies of that pig... Wait three months, three weeks, and three days—the gestation period of a sow—and, hopefully, you get a litter of identical pigs expressing the genes you want" .

How does UCP2 mechanistically regulate mitochondrial ROS production and what are the best methods to measure this activity?

UCP2 functions as a critical regulator of mitochondrial ROS production through its mild uncoupling activity. The mechanism involves:

  • Slight dissipation of the proton gradient across the inner mitochondrial membrane

  • Reduction of mitochondrial membrane potential

  • Decreased electron leakage from the respiratory chain

  • Reduced superoxide formation at complexes I and III

Methodological approaches to measure UCP2-mediated ROS regulation:

TechniqueApplicationAdvantagesLimitations
High-resolution respirometryMeasures oxygen consumption and OXPHOS efficiencyQuantitative, detects subtle changesRequires specialized equipment
Fluorescent ROS indicatorsDirect measurement of H₂O₂, superoxideReal-time monitoring possiblePotential artifacts, probe specificity
Membrane potential dyes (TMRM, JC-1)Quantifies Δψm changesDirect measurement of UCP2 primary effectSome dyes affect mitochondrial function
Lipid peroxidation assaysMeasures downstream effects of ROSIndicates physiological impactIndirect measurement of UCP2 activity
EPR spectroscopyDirect detection of free radicalsHighly specificTechnical complexity

Knockout studies have demonstrated that Ucp2-/- mice exhibit increased mitochondrial ROS production, confirming UCP2's critical role in regulating oxidative stress .

What is the role of UCP2 in cancer progression and chemoresistance, and how can this inform therapeutic approaches?

UCP2 demonstrates complex roles in cancer biology, functioning as both a potential tumor promoter and suppressor depending on cancer type and context:

Cancer resistance mechanisms involving UCP2:
Research has demonstrated that "mitochondrial uncoupling by UCP2 is a mechanism of cancer cell resistance to the standard chemotherapeutic drug gemcitabine by regulating mitochondrial superoxide production" . UCP2 inhibition has shown a synergistic antiproliferative effect with gemcitabine in pancreatic adenocarcinoma cells .

UCP2 in cancer prognosis:
Pan-cancer analysis revealed varied prognostic significance of UCP2 expression:

Cancer TypeHR Valuep-valueAssociation
KIRP1.3360.018Risk factor
LAML1.9210.0002Risk factor
LGG1.3920.0002Risk factor
CESC0.7190.004Improved survival
LUAD0.7660.008Improved survival
OV0.8490.019Improved survival
SARC0.7820.011Improved survival

Table based on data from

Methodological approaches for investigating UCP2 in cancer:

  • Xenograft models with UCP2-modulated cancer cells

  • Patient-derived organoids with UCP2 inhibition/overexpression

  • Co-treatment strategies combining UCP2 modulators with standard chemotherapeutics

  • Metabolic flux analysis to determine how UCP2 affects cancer cell bioenergetics

  • Single-cell RNA sequencing to identify UCP2-expressing populations within tumors

How does UCP2 influence immune cell function and the tumor microenvironment?

UCP2 has significant effects on immune function and the tumor microenvironment, particularly in cancer contexts:

Immune pathway correlations:
KEGG enrichment analysis revealed that high UCP2 expression correlates with upregulated immune-related pathways, including:

  • B cell receptor signaling

  • T cell receptor signaling

  • Leukocyte transendothelial migration

GO enrichment results similarly showed UCP2 expression associations with:

  • Antigen receptor-mediated signaling

  • T cell differentiation in immune responses

  • Antigen processing and presentation

  • Alpha-beta T cell differentiation

Immune cell correlations:
UCP2 correlates positively with CD8+ T cells and M1 macrophages, while negatively with M2 macrophages in breast cancer, suggesting "UCP2 may suppress tumor proliferation by regulating CD8+ T cell infiltration and macrophage polarization" .

Methodological approaches:

  • Flow cytometry to quantify immune cell populations in UCP2-modulated models

  • Multiplex cytokine assays to assess inflammatory mediator profiles

  • Immune cell co-culture systems with UCP2-modified cancer cells

  • In vivo models evaluating immunotherapy response in UCP2-modulated tumors

  • Spatial transcriptomics to map UCP2 expression relative to immune infiltrates

What is the significance of UCP2 in cardiovascular disease models and how can recombinant pig UCP2 advance this research?

UCP2 plays a critical protective role in cardiovascular health:

  • Vascular protection: UCP2 "is being increasingly recognized as an important molecule to defend against various stress signals such as oxidative stress" in the cardiovascular system .

  • Atherosclerosis: "The deletion of the UCP2 gene contributes to atherosclerosis lesion development in the knockout mice, also showing significantly shorter lifespan" .

  • Hypertension: "UCP2 gene downregulation is a key determinant of higher predisposition to renal and cerebrovascular damage in an animal model of spontaneous hypertension and stroke" .

  • Endothelial function: "UCP2 overexpression improves both hyperglycemia- and high-salt diet-induced endothelial dysfunction and ameliorates hypertensive target organ damage" .

Methodological approaches using recombinant pig UCP2:

  • Ex vivo perfusion studies of pig coronary vessels with recombinant UCP2

  • Incorporation of recombinant UCP2 into cardiomyocyte cultures under stress conditions

  • Comparative studies between native and recombinant UCP2 in pig cardiovascular tissues

  • Development of UCP2-targeted nanoparticles for localized delivery to vascular lesions

  • Non-invasive imaging to track ROS in cardiovascular tissues following UCP2 modulation

What cutting-edge techniques can be applied to study UCP2 regulation at multiple levels?

UCP2 is regulated at multiple levels, requiring comprehensive methodological approaches:

Regulatory LevelTechniquesApplications
TranscriptionalChIP-seq, ATAC-seqIdentify transcription factor binding sites and chromatin accessibility
Post-transcriptionalRNA-seq, ribosome profilingAnalyze mRNA stability and translation efficiency
Post-translationalMass spectrometry, phosphoproteomicsIdentify modifications affecting UCP2 function
Protein-protein interactionsBioID, proximity labelingMap UCP2 interactome in native environment
Protein dynamicsFRAP, single-molecule trackingAnalyze UCP2 mobility and turnover in mitochondria
Structural dynamicsCryo-EM, HDX-MSDetermine UCP2 conformational changes

Methodological considerations:
When designing experiments to investigate UCP2 regulation, researchers should:

  • Use multiple complementary approaches to confirm findings

  • Consider tissue-specific and context-dependent regulation

  • Develop time-course experiments to capture dynamic regulation

  • Apply systems biology approaches to integrate multi-omics data

  • Validate findings across species to identify conserved regulatory mechanisms

How can researchers effectively analyze UCP2 function in the context of mitochondrial dynamics and quality control?

Methodological approach:

  • Mitochondrial morphology analysis:

    • Super-resolution microscopy (STED, STORM) to visualize UCP2 distribution

    • Live-cell imaging with mitochondrial markers to track fusion/fission events

    • Electron microscopy to assess cristae structure in UCP2-modulated mitochondria

  • Mitophagy assessment:

    • mt-Keima pH-sensitive reporters to quantify mitophagy flux

    • Colocalization of mitochondrial markers with autophagy proteins

    • Western blot analysis of PINK1/Parkin pathway components

  • Mitochondrial quality control:

    • Measurement of mitochondrial DNA damage and mutation rates

    • Protein oxidation and carbonylation assays

    • Mitochondrial proteomics to assess protein turnover

  • Advanced functional assays:

    • Seahorse XF analysis with specific inhibitors to isolate UCP2 contributions

    • Patch-clamp of mitoplasts to directly measure proton conductance

    • In situ calcium imaging to assess mitochondrial calcium handling

  • Genetic approaches:

    • CRISPR-interference for temporal control of UCP2 expression

    • Optogenetic control of UCP2 activity

    • Mitochondria-targeted transcription factors to modulate UCP2 expression

The research showing that "UCP2 inhibition triggers ROS-dependent nuclear translocation of the glycolytic enzyme GAPDH and autophagic cell death" highlights the importance of studying UCP2 in the context of broader cellular quality control mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.