Recombinant Pig Mitochondrial uncoupling protein 3 (UCP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes section, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
UCP3; SLC25A9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
UCP3
Target Protein Sequence
MVGLKPPEVPPTTAVKLLGAGTAACFADLLTFPLDTAKVRLQIQGENQAARSAQYRGVLG TILTMVRNEGPRSPYNGLVAGLQRQMSFASIRIGLYDSVKQLYTPKGSDHSSITTRILAG CTTGAMAVTCAQPTDVVKVRFQASIHAGPRSNRKYSGTMDAYRTIAREEGVRGLWKGILP NITRNAIVNCAEMVTYDVIKEKVLDYHLLTDNLPCHFVSAFGAGFCATVVASPVDVVKTR YMNSPPGQYQNPLDCMLKMVTQEGPTAFYKGFTPSFLRLGSWNVVMFVSYEQLKRALMKV QMLRESPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation. As a consequence, energy is dissipated as heat. UCPs may play a regulatory role in tissue respiratory control. They are involved in thermogenesis and energy balance.
Gene References Into Functions
  1. Association of pig UCP3 gene mutations and back fat thickness in the sixth and seventh rib. PMID: 21643758
  2. Seven deletion polymorphisms were identified within introns of linkage genes for UCP2 and UCP3, demonstrating the conservation and genetic reliability of UCPs. PMID: 17221299
  3. In vivo studies suggest that beta-adrenergic agonists may regulate UCP2 and UCP3 expression in specific muscles. PMID: 17383207
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of porcine UCP3 and how does it compare to other species?

Porcine UCP3 contains an open reading frame of 936 base pairs that shares remarkable homology with other mammalian species: 90% similarity with bovine, 89% with human, and 85% with rat UCP3 nucleotide sequences . The gene's 5'-flanking region (2 kb upstream of the initiation codon) contains two CpG islands: one located between nucleotides -1,603 to -1,501 and another between -910 to -777, with the latter positioned within the core promoter region (nucleotides -870 to -550) . This core promoter region contains several putative transcription factor binding sites, including Sp1 transcription factor, neurofibromin 1, CCAAT enhancer binding protein beta, transcription factor AP-2 alpha, CCAAT enhancer binding protein alpha, and organic cation/carnitine transporter 1 .

How does porcine UCP3 function differ from other UCPs in the context of pig physiology?

Porcine UCP3 function must be understood in the context of pig-specific UCP biology. Unlike most mammals, pigs lack functional brown adipose tissue (BAT) due to the genetic loss of functional uncoupling protein 1 (UCP1) . This evolutionary loss creates a unique metabolic scenario where UCP3 may play a compensatory role. Molecular docking studies indicate that porcine UCP2 binds adenosine triphosphate (ATP) more strongly than UCP3, suggesting differential roles in energy metabolism regulation . In human cells, UCP1 is more active than UCP3, but in pig adipocytes, the absence of functional UCP1 has likely triggered elevated UCP3 activity . This indicates that UCP3 serves a critical function in porcine energy metabolism, particularly in cold adaptation and thermoregulation, functions typically associated with UCP1 in other mammals.

What are the recommended techniques for assessing UCP3 expression in porcine tissues?

For comprehensive UCP3 expression analysis in porcine tissues, a multi-method approach is recommended:

  • Quantitative Real-Time PCR (Q-PCR): The gold standard for measuring UCP3 mRNA expression levels in various pig tissues. This method was successfully used to detect significant differences in UCP3 expression across different ages and breeds .

  • RT-PCR for Initial Detection: For cloning and initial detection of UCP3 mRNA in different tissues. This technique successfully identified UCP3 expression in both adipose tissue and skeletal muscles of 3-5 day old piglets .

  • Tissue Sampling Protocols: For skeletal muscle, sampling from both oxidative (e.g., rhomboïdeus) and glycolytic (e.g., longissimus thoracis) muscles is advised to capture metabolic type differences. For adipose tissue, sampling from subcutaneous depots is standard practice .

  • Reference Gene Selection: When performing relative quantification, careful selection of stable reference genes is crucial. Multiple reference genes should be validated for the specific experimental conditions being studied.

  • Protein Detection Methods: Western blotting with validated antibodies should complement mRNA analysis to confirm translation of the transcript.

What methods are used to study the epigenetic regulation of porcine UCP3?

Epigenetic regulation of porcine UCP3 can be studied using the following methodologies:

  • Bisulfite Sequencing PCR: This is the primary method for analyzing methylation patterns in the UCP3 promoter region. The technique involves bisulfite treatment of DNA (which converts unmethylated cytosines to uracil), followed by PCR amplification and sequencing .

  • Methylation Analysis Workflow:

    • Bisulfite treatment of genomic DNA

    • PCR amplification of the target region (e.g., CpG island 2 containing 9 CpG sites in the UCP3 promoter)

    • Cloning of PCR products

    • Sequencing of positive recombinant clones

    • Comparative analysis of methylation status

  • Correlation Analysis: Pearson's correlation analysis can be used to determine the relationship between methylation status and gene expression. Research has shown a significant negative correlation (r = -0.82 or -0.72; p<0.01) between methylation status and UCP3 expression in skeletal muscle .

  • Site-Specific Analysis: Individual CpG sites can be analyzed separately for their impact on expression. For example, CpG_9 showed significant correlation with UCP3 expression in Putian Black pigs across three developmental stages (r = -0.632; p<0.05) .

How does UCP3 expression differ among pig breeds and what are the implications for research?

UCP3 expression exhibits significant breed-specific variations with important research implications:

Expression Data Comparison Across Breeds:

Pig BreedRelative UCP3 Expression in Skeletal Muscle (90 days of age)Methylation StatusNotable Characteristics
DupuHighestLowestCommercial crossbred line
Putian BlackIntermediateIntermediateNative Chinese breed known for meat quality
DurocLowestHighestInternational commercial breed

The breed-specific differences in UCP3 expression correlate negatively with promoter methylation status, suggesting epigenetic mechanisms underlying these variations . These differences have several implications:

  • Meat Quality Research: Higher UCP3 expression in native Chinese breeds (e.g., Putian Black) compared to international commercial breeds (e.g., Duroc) may contribute to their renowned meat quality characteristics .

  • Genetic Resource Utilization: Indigenous breeds with unique UCP3 expression patterns represent valuable genetic resources for breeding programs focused on meat quality improvement.

  • Experimental Design Considerations: Researchers must account for breed-specific baseline expression when designing comparative studies, as the same experimental treatment may produce different magnitudes of response in different breeds.

  • Genetic Marker Development: The identified breed differences support the potential use of UCP3-related polymorphisms as genetic markers in breeding programs targeting meat quality traits.

What UCP3 polymorphisms have been identified in pigs and how do they affect protein function?

Several UCP3 polymorphisms have been identified in pigs with potential functional implications:

  • Promoter Region Polymorphisms: Two novel single nucleotide polymorphisms (SNPs) were identified in the 5'-flanking region of porcine UCP3: -882 A/T and -852 G/A . These variants are located in the putative promoter region and may affect transcription factor binding and gene expression.

  • Coding Region Polymorphisms: Three coding-region SNPs have been detected in the UCP3 gene, with one mutation showing significant associations with several carcass and meat quality traits .

  • 3'UTR Variation: A 9-base continuous mutated site in the 3'UTR of pig UCP3 gene has been identified and significantly associated with backfat thickness at the sixth and seventh rib .

  • Missense Substitution: A novel missense substitution (g.946C>T) potentially associated with porcine abdominal fat weight has been reported .

  • Cold Resistance Association: UCP3 sequence variations have been used to classify eight dominant Chinese pig breeds into cold-sensitive and cold-resistant categories, suggesting functional adaptations .

The functional impact of these polymorphisms appears to be primarily through altered gene expression rather than protein structure changes, influencing traits related to fat deposition, carcass composition, and environmental adaptation.

How can recombinant porcine UCP3 be used to study mitochondrial function and energy metabolism?

Recombinant porcine UCP3 provides a valuable tool for studying mitochondrial energetics through several advanced approaches:

  • Proton Leak Measurements: Recombinant UCP3 can be used to investigate its direct effect on mitochondrial proton leak. This can be assessed through:

    • Oxygen consumption measurements in isolated mitochondria

    • Membrane potential assessments using fluorescent probes

    • Simultaneous measurements of both parameters to construct proton leak kinetics curves

  • Mitochondrial Respiration Analysis: High-resolution respirometry can determine how UCP3 affects different respiratory states and substrate utilization patterns in porcine mitochondria.

  • ATP Synthesis Rate Determination: By comparing phosphocreatine (PCr) resynthesis rates in tissues with differential UCP3 expression, researchers can assess the impact of UCP3 on ATP production efficiency .

  • Molecular Interaction Studies: Recombinant UCP3 enables the investigation of protein-ligand interactions. For example, molecular docking studies have revealed differential ATP binding capacities between UCP3 and UCP2 in pigs, with UCP2 binding ATP more strongly . This suggests a regulatory mechanism where UCP3 activity may be less inhibited by ATP compared to UCP2.

  • Tissue-Specific Energy Metabolism Models: The differential expression of UCP3 in various tissues (high in skeletal muscle, variable in adipose tissue) allows for the development of tissue-specific models to study energy metabolism regulation .

What is the relationship between UCP3 methylation status and gene expression in different porcine tissues?

The relationship between UCP3 methylation and expression shows tissue-specific patterns with important regulatory implications:

In Skeletal Muscle:

  • A strong negative correlation exists between methylation status of CpG island 2 (located in the core promoter region) and UCP3 mRNA expression (r = -0.82 or -0.72; p<0.01)

  • Methylation levels follow a dynamic age-dependent pattern that inversely tracks with expression changes

  • In Putian Black pigs, the methylation level in skeletal muscle is lowest at 90 days of age, corresponding to peak UCP3 expression

  • Different pig breeds show distinct methylation patterns that correlate with their UCP3 expression levels (e.g., highest methylation and lowest expression in Duroc)

In Adipose Tissue:

  • Despite detectable changes in methylation status across different ages, these variations do not reach statistical significance

  • Similarly, UCP3 mRNA expression shows no significant differences in adipose tissue across different age groups

  • This suggests tissue-specific epigenetic regulation mechanisms

The data indicate that CpG methylation is a primary regulatory mechanism for UCP3 expression in skeletal muscle but likely plays a lesser role in adipose tissue regulation. This tissue-specific epigenetic regulation may contribute to the specialized functions of UCP3 in different tissues and developmental stages.

How does cold stress affect UCP3 expression in porcine tissues and what are the molecular mechanisms involved?

Cold stress significantly impacts UCP3 expression in porcine tissues through multiple molecular pathways:

Expression Changes:
Cold stress triggers increased UCP3 expression in pig adipocytes as part of the thermoregulatory response . This upregulation is particularly significant in pigs due to their evolutionary loss of functional UCP1, which typically mediates adaptive thermogenesis in other mammals .

Molecular Mechanisms:

  • Compensatory Activation: The absence of functional UCP1 in pigs has likely triggered a compensatory increase in UCP3 activity during cold stress .

  • Protein-Ligand Interactions: Molecular docking studies reveal that porcine UCP2 binds ATP more strongly than UCP3, suggesting that UCP3 may be less inhibited by ATP during cold stress, allowing for greater uncoupling activity .

  • Fatty Acid Metabolism Integration: Cold stress activates adipocyte triglyceride lipase (ATGL), increasing free fatty acid (FFA) availability. These FFAs can potentially serve as activators of UCP3, enhancing its uncoupling activity .

  • Mitochondrial Remodeling: Cold stress induces mitochondrial biogenesis and remodeling in adipocytes, creating an environment where increased UCP3 can have a more significant impact on cellular energetics.

  • Beige Adipocyte Recruitment: In the absence of classical brown fat (due to UCP1 deficiency), cold exposure may promote beige adipocyte development in white adipose depots with enhanced UCP3 expression .

These mechanisms collectively enable pigs to adapt to cold environments despite lacking the primary thermogenic mechanism (UCP1) found in most other mammals.

What role does UCP3 play in porcine meat quality and how can this knowledge be applied in breeding programs?

UCP3 has emerged as a significant factor in determining porcine meat quality through several mechanisms:

  • Intramuscular Fat Regulation: UCP3 is recognized as an important candidate gene for regulating intramuscular fat, which directly affects meat tenderness, juiciness, and flavor . The negative correlation between UCP3 expression and fat deposition suggests its involvement in lipid metabolism pathways that influence marbling.

  • Breed-Specific Quality Differences: Native breeds like Putian Black pigs, known for superior meat taste and fragrance, show distinct UCP3 expression patterns compared to commercial breeds . These expression differences may contribute to their distinguished meat characteristics.

  • Genetic Markers for Selection: Several UCP3 polymorphisms show significant associations with meat quality traits:

    • A missense substitution (g.946C>T) associated with abdominal fat weight

    • A 9-base continuous mutated site in 3'UTR associated with backfat thickness

    • Coding-region SNPs affecting carcass and meat quality traits

  • Energy Metabolism Effects: UCP3's role in mitochondrial energy efficiency may influence postmortem muscle metabolism, affecting meat pH decline, color development, and water-holding capacity.

Applications in Breeding Programs:

  • Marker-Assisted Selection: The identified UCP3 polymorphisms can be incorporated into marker-assisted selection programs targeting improved meat quality traits.

  • Epigenetic Considerations: Understanding the methylation patterns of UCP3 promoters allows for potential epigenetic selection strategies.

  • Breed Conservation: Indigenous breeds with favorable UCP3 variants represent valuable genetic resources for quality-focused breeding programs.

  • Age-Optimized Processing: Knowledge of age-dependent UCP3 expression patterns can inform optimal slaughter age decisions to maximize meat quality attributes.

How does the absence of functional UCP1 in pigs affect the physiological role of UCP3?

The evolutionary loss of functional UCP1 in pigs has created a unique physiological scenario that reshapes UCP3's role:

Compensatory Thermogenic Function:
Pigs are among the few species that lack functional brown adipose tissue (BAT) due to the genetic loss of functional UCP1 . This absence creates a thermogenic gap that UCP3 partially compensates for, particularly during cold stress. Unlike most mammals where UCP1 is the primary mediator of adaptive thermogenesis, pigs rely on alternative mechanisms including enhanced UCP3 activity .

Altered Tissue Activity Patterns:
Without UCP1, the relative importance of UCP3 is elevated in porcine tissues. This is evidenced by:

  • Cold stress studies showing significant UCP3 upregulation in pig adipocytes

  • Molecular docking results revealing that in pigs, UCP2 binds ATP more strongly than UCP3, potentially leaving UCP3 more active under physiological conditions

  • The hypothesis that in pig adipocytes, UCP3 plays a more prominent role while UCP2 serves as a backup when UCP3 cannot fulfill its function

Metabolic Adaptation Consequences:
The UCP1 deficiency and resultant UCP3 compensation has several physiological implications:

This evolutionary adaptation makes pigs an excellent model for studying alternative thermogenic mechanisms and the plasticity of mitochondrial uncoupling systems.

What are the key considerations when expressing and purifying recombinant porcine UCP3 for functional studies?

Successful expression and purification of recombinant porcine UCP3 requires attention to several critical factors:

  • Expression System Selection:

    • Bacterial Systems: While cost-effective, they often struggle with proper folding of membrane proteins like UCP3

    • Yeast Systems (e.g., Pichia pastoris): Offer better eukaryotic protein processing capabilities

    • Insect Cell Systems: Provide superior post-translational modifications and membrane protein folding

    • Mammalian Cell Systems: Offer the most native-like processing but at higher cost and complexity

  • Construct Design Considerations:

    • Affinity Tags: N-terminal or C-terminal tags (His, FLAG, etc.) must be positioned to avoid interference with protein folding or function

    • Signal Sequences: May require mitochondrial targeting sequences for proper localization in eukaryotic systems

    • Codon Optimization: Adaptation to the expression host's codon bias improves yield

    • Fusion Partners: Solubility-enhancing partners may improve expression but must be removable without affecting function

  • Membrane Protein Solubilization:

    • Detergent Selection: Critical for extracting UCP3 while maintaining native conformation

    • Common Effective Detergents: n-Dodecyl β-D-maltoside (DDM), digitonin, or CHAPS

    • Lipid Addition: Including phospholipids during purification can stabilize protein structure

  • Purification Strategy:

    • Two-Step Minimum: Typically involves affinity chromatography followed by size exclusion

    • On-Column Detergent Exchange: Allows transition to detergents more suitable for functional studies

    • Quality Control: Assessing homogeneity by SDS-PAGE and Western blotting

  • Functional Validation:

    • Reconstitution in Liposomes: Required to assess proton transport activity

    • Membrane Potential Assays: Using fluorescent probes to measure uncoupling activity

    • ATP Binding Studies: To confirm regulatory interactions

  • Storage Considerations:

    • Cryoprotectants: Addition of glycerol or sucrose

    • Temperature: Typically -80°C for long-term storage

    • Avoiding Freeze-Thaw Cycles: Aliquoting to prevent repeated freezing and thawing

What are the major experimental challenges in studying UCP3 function in porcine mitochondria and how can they be overcome?

Studying UCP3 function in porcine mitochondria presents several technical challenges that require specialized approaches:

Challenge 1: Isolating Functional Mitochondria

  • Problem: Obtaining intact, functional mitochondria from porcine tissues is difficult due to tissue-specific characteristics and post-mortem changes.

  • Solutions:

    • Use specialized isolation buffers containing protective agents (e.g., EGTA, BSA, and protease inhibitors)

    • Implement gentle homogenization techniques (e.g., Dounce homogenizer rather than blender)

    • Perform rapid isolations from fresh tissue (<4 hours post-mortem)

    • Validate mitochondrial integrity using cytochrome c control experiments

Challenge 2: Distinguishing UCP3-Specific Effects

  • Problem: Separating UCP3 activity from other mitochondrial proteins that affect proton conductance.

  • Solutions:

    • Use specific inhibitors (e.g., GDP which inhibits UCP activity)

    • Compare tissues with different UCP3 expression levels (e.g., glycolytic vs. oxidative muscles)

    • Employ genetically modified systems with controlled UCP3 expression

    • Measure multiple parameters simultaneously (respiration, membrane potential, ROS production)

Challenge 3: Tissue Heterogeneity

  • Problem: Different muscle types have varying UCP3 expression levels and mitochondrial characteristics.

  • Solutions:

    • Clearly define and consistently sample specific muscle locations

    • Consider fiber type composition in experimental design

    • Use laser capture microdissection for fiber-specific analyses

    • Normalize data to mitochondrial content markers (e.g., citrate synthase activity)

Challenge 4: Post-Translational Modifications

  • Problem: UCP3 function is affected by post-translational modifications that may be lost during isolation.

  • Solutions:

    • Use phosphatase inhibitors during isolation

    • Employ approaches to detect post-translational modifications (e.g., mass spectrometry)

    • Consider in situ approaches to complement isolated mitochondria studies

Challenge 5: Physiological Context

  • Problem: Isolated mitochondria studies may not reflect in vivo conditions.

  • Solutions:

    • Complement with permeabilized fiber techniques that maintain cellular architecture

    • Validate findings with in vivo measurements (e.g., 31P-MRS to measure phosphocreatine resynthesis)

    • Develop 3D tissue culture systems that better mimic physiological conditions

What emerging technologies might advance our understanding of porcine UCP3 function and regulation?

Several cutting-edge technologies show promise for deepening our understanding of porcine UCP3:

  • CRISPR-Cas9 Gene Editing:

    • Creation of UCP3 knock-out or knock-in pig models to directly assess function

    • Introduction of specific polymorphisms identified in different breeds to evaluate their effects

    • Targeted epigenetic modifications of UCP3 promoter regions to study methylation effects in vivo

  • Single-Cell Transcriptomics and Proteomics:

    • Characterization of UCP3 expression heterogeneity within tissues

    • Identification of cell-specific regulatory networks

    • Mapping of UCP3 co-expression patterns with other genes involved in energy metabolism

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize UCP3 distribution within mitochondrial membranes

    • FRET-based sensors to monitor UCP3 conformational changes in response to activators/inhibitors

    • In vivo imaging of mitochondrial energetics in UCP3-variant models

  • Cryo-Electron Microscopy:

    • Determination of high-resolution UCP3 structure to understand functional mechanisms

    • Visualization of UCP3 interactions with regulators (e.g., ATP, fatty acids)

    • Comparative structural analysis between UCP3 and other UCP family members

  • Multi-Omics Integration Approaches:

    • Combined analysis of genomics, epigenomics, transcriptomics, proteomics, and metabolomics data

    • Systems biology modeling of UCP3's role in whole-body energy metabolism

    • Machine learning applications to identify novel regulatory patterns

  • Organoid and Tissue-on-a-Chip Technologies:

    • Development of porcine muscle or adipose organoids with controlled UCP3 expression

    • Microfluidic systems to study tissue-specific responses to metabolic challenges

    • Co-culture systems to investigate inter-tissue signaling affecting UCP3 regulation

How might research on porcine UCP3 contribute to our understanding of human metabolic disorders?

Porcine UCP3 research offers valuable insights for human metabolic disorders through several translational pathways:

  • Unique Model for UCP1-Independent Thermogenesis:

    • Pigs naturally lack functional UCP1, making them excellent models for studying alternative thermogenic mechanisms relevant to humans with brown adipose tissue dysfunction

    • Understanding how pigs regulate energy expenditure through UCP3 could reveal therapeutic targets for obesity in humans with compromised brown fat function

  • Comparative Methylation Patterns:

    • The negative correlation between UCP3 promoter methylation and expression in porcine tissues parallels epigenetic mechanisms in human metabolic disorders

    • Porcine models allow for controlled dietary and environmental interventions to study how these factors affect UCP3 methylation and metabolic outcomes

  • Skeletal Muscle Energy Metabolism:

    • UCP3's prominent role in porcine skeletal muscle offers insights into mitochondrial efficiency and its impact on insulin sensitivity

    • Research showing how porcine UCP3 affects phosphocreatine resynthesis rates could inform understanding of muscle fatigue and exercise intolerance in human metabolic disorders

  • Genetic Variation Studies:

    • The identified polymorphisms in porcine UCP3 and their associations with metabolic traits provide candidate variants to investigate in human populations

    • Breed-specific differences in pigs may help explain ethnic variations in human metabolic disease susceptibility

  • Therapeutic Target Validation:

    • Pigs offer a physiologically relevant large animal model for testing UCP3-targeted interventions before human trials

    • Their size and metabolic similarity to humans make them ideal for developing metabolic imaging techniques to monitor treatment effects

  • Age-Dependent Regulation:

    • The developmental pattern of UCP3 expression in pigs may inform understanding of age-related metabolic changes in humans

    • Insights from porcine studies could help develop age-appropriate interventions for metabolic disorders across the human lifespan

What are the most significant recent advances in porcine UCP3 research?

The field of porcine UCP3 research has seen several significant advances that have expanded our understanding of this protein's role in pig metabolism and physiology:

  • Epigenetic Regulation Mechanisms: The discovery that UCP3 promoter methylation strongly correlates with expression levels in skeletal muscle (r = -0.82 or -0.72; p<0.01) has revealed a key regulatory mechanism . This epigenetic control shows tissue-specific patterns and developmental changes, providing insight into how UCP3 function is modulated throughout the pig's life.

  • Breed-Specific Expression Patterns: Research has established clear differences in UCP3 expression among pig breeds, with native Chinese breeds like Putian Black showing distinct patterns compared to international commercial breeds like Duroc . These differences correlate with meat quality characteristics and suggest genetic selection has influenced UCP3 function.

  • Compensatory Role in Thermogenesis: Given the evolutionary loss of functional UCP1 in pigs, research has demonstrated that UCP3 likely serves a compensatory role in thermogenesis and energy metabolism . This adaptation represents a unique aspect of porcine physiology with implications for understanding energy balance regulation.

  • Molecular Binding Interactions: Molecular docking studies have revealed that porcine UCP2 binds ATP more strongly than UCP3, suggesting differential regulation of these proteins . This finding helps explain their respective roles in cellular energy metabolism and response to physiological challenges like cold stress.

  • Complete UCP3 cDNA Cloning: The successful cloning and sequencing of complete porcine UCP3 cDNA has provided the foundation for recombinant protein studies and comparative analyses with other species .

  • Functional Impact Clarification: Research has helped clarify that UCP3 does not simply diminish PCr resynthesis rates, challenging simplistic views of its uncoupling function . This suggests more complex roles in cellular energy homeostasis than previously recognized.

What consensus exists regarding the primary physiological role of UCP3 in pigs?

Current evidence supports several primary physiological roles for UCP3 in pigs, with varying degrees of consensus:

Strong Consensus Areas:

  • Skeletal Muscle Energy Metabolism Regulation: There is strong agreement that UCP3 plays a significant role in regulating energy efficiency in porcine skeletal muscle, with expression levels varying by muscle type, breed, and developmental stage .

  • Meat Quality Determinant: Multiple studies have established connections between UCP3 polymorphisms and meat quality traits, supporting its role in intramuscular fat regulation and other quality-related metabolic processes .

  • Compensatory Thermogenic Function: In the absence of functional UCP1, there is growing consensus that UCP3 assumes increased importance in porcine thermoregulation, particularly during cold stress adaptation .

Emerging Consensus Areas:

  • Epigenetic Regulation Target: Methylation of the UCP3 promoter region is increasingly recognized as a key regulatory mechanism, particularly in skeletal muscle where strong negative correlations with expression have been documented .

  • Breed-Specific Adaptive Role: The distinct patterns of UCP3 expression and regulation observed across pig breeds suggest it plays an important role in breed-specific metabolic adaptations, including those related to meat quality characteristics and environmental tolerance .

Areas Requiring Further Research:

  • Precise Uncoupling Mechanism: While UCP3 is known to affect mitochondrial function, there remains debate about its precise mechanism of action and the physiological conditions under which it becomes activated .

  • Interaction with UCP2: The relationship between UCP2 and UCP3 in pigs, particularly regarding their relative contributions to cellular energy metabolism, remains an active area of investigation with evidence suggesting differential ATP binding affinities .

  • Developmental Programming: How early life factors influence UCP3 expression and methylation patterns throughout the pig's lifespan requires additional research to fully understand its long-term metabolic impacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.