| Region | Sequence (Partial) |
|---|---|
| N-terminal | MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN... |
| Transmembrane 3 | VSFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGT... |
Recombinant Pig CHRM1 is widely used in:
Drug discovery: Screening for ligands targeting neurodegenerative disorders .
Signal transduction studies: Elucidating GPCR pathways in bronchoconstriction and gastric acid secretion .
Antibody validation: Western blot (WB) using antibodies like ab77098 .
| Species | Expression System | Tag | Applications |
|---|---|---|---|
| Pig | E. coli | His | SDS-PAGE, receptor-ligand assays |
| Human | HEK293 | None | Cell signaling studies |
| Rat | Mammalian cells | His | Neuromuscular studies |
Mediates vagally-induced bronchoconstriction and gastrointestinal acid secretion .
Linked to cognitive deficits in frontotemporal dementia and amyotrophic lateral sclerosis (ALS) .
CHRM1 is a G protein-coupled acetylcholine receptor predominantly expressed in the cerebral cortex. In humans, it is encoded by the CHRM1 gene localized to chromosome 11q13 . The receptor is part of a larger family of G protein-coupled receptors that respond to acetylcholine binding. CHRM1 is characterized by its role in mediating slow excitatory postsynaptic potentials (EPSPs) at ganglia in postganglionic nerves and is commonly found in exocrine glands and the central nervous system .
For characterization in experimental settings, researchers typically use techniques such as western blotting, where CHRM1 has a predicted band size of 51 kDa but often appears at approximately 48 kDa when analyzed in human brain lysates . Recombinant polyclonal antibodies against CHRM1 are available for research applications including immunocytochemistry and western blotting .
CHRM1 predominantly signals through G proteins of class Gq, which triggers the upregulation of phospholipase C. This activation leads to the production of inositol trisphosphate and increased intracellular calcium as a signaling pathway . The primary transducing effect is phosphoinositide (Pi) turnover .
Additionally, CHRM1 can signal through alternative pathways:
CHRM1 can activate Gs alpha, which stimulates adenylyl cyclase activity to produce cyclic adenosine monophosphate (cAMP), independent of phospholipase C activation .
It can also signal through Gi, causing a downstream decrease in cAMP levels .
Depending on cell type, CHRM1 activation may trigger other cellular effectors such as mitogen-activated protein kinase (MAPK) .
These diverse signaling mechanisms contribute to the wide range of physiological effects mediated by CHRM1 in different tissues and cell types.
Significant species-dependent variations exist in CHRM1 expression patterns, particularly in parvalbumin-immunoreactive (PV-ir) neurons:
| Species | % of PV-ir Neurons Expressing CHRM1 | Notes |
|---|---|---|
| Macaques | 74-85% | High expression |
| Humans | 74-85% | High expression |
| Guinea pigs | 74-85% | High expression |
| Ferrets | 41% | Moderate expression |
| Rats | 27% | Low expression |
These variations have profound implications for translational research . Physiological studies have confirmed these differences, showing strong cholinergic modulation effects on PV neurons in guinea pigs but not in rats . Researchers should exercise caution when extrapolating findings from rodent models to human applications, particularly in studies involving cholinergic modulation of cortical circuits.
For cross-species comparative studies, it is essential to validate antibody specificity for each target species. For example, while antibodies might work effectively with monkey, pig, house, and rat samples, they may not be suitable for other species without proper validation . These species differences should inform model selection in neuropharmacological research targeting muscarinic systems.
Recent research has revealed significant associations between CHRM1 loss and Alzheimer's disease (AD) pathophysiology. A postmortem brain tissue study demonstrated that severely reduced CHRM1 proteins (≥50% decrease) in the temporal cortex of AD patients significantly correlated with poor clinical outcomes . This finding suggests that CHRM1 may serve as a potential biomarker or therapeutic target in AD.
The mechanistic link between CHRM1 loss and AD pathophysiology appears to involve mitochondrial dysfunction. Knockout studies in mice (Chrm1-/-) have shown that loss of CHRM1 leads to:
Significant reduction in cortical mitochondrial respiration (oxygen consumption)
Reduced oligomerization of ATP synthase (complex V)
Decreased supramolecular assembly of complexes I-IV (Respirasome)
Mitochondrial ultrastructural defects
Alterations in the tinctorial properties of cortical neurons
Significant increase in the abundance of dark cortical neurons (85% in Chrm1-/- versus 2% in wild-type)
These findings suggest that CHRM1 loss may contribute to AD pathogenesis through mitochondrial dysfunction, providing a novel perspective on the cholinergic hypothesis of AD beyond the traditional focus on acetylcholine levels alone.
For researchers interested in CHRM1-targeted approaches in neurodegenerative disease research, several methodological considerations are crucial:
Mitochondrial Function Assessment: Given CHRM1's role in mitochondrial function, researchers should incorporate measurements of mitochondrial respiration using techniques like high-resolution respirometry or oxygen consumption rate measurements .
Protein Complex Analysis: The study of ATP synthase oligomerization and respirasome assembly requires specialized techniques such as two-dimensional blue-native polyacrylamide gel electrophoresis followed by sodium dodecyl-sulfate polyacrylamide gel electrophoresis (2D BN-PAGE/BN-PAGE) .
Ultrastructural Analysis: Transmission electron microscopy (TEM) is essential for examining mitochondrial ultrastructure in neuronal tissue following CHRM1 manipulation .
Restoration Studies: Overexpression of CHRM1 in transformed cells (lacking native CHRM1) has been shown to significantly increase complex V oligomerization and respirasome assembly, leading to enhanced respiration . This approach can be valuable for mechanistic validation and potential therapeutic development.
Behavioral Assessment: Since CHRM1 mediates cognitive flexibility, synaptic plasticity, anxiety-like behavior, and working memory , comprehensive behavioral testing should accompany molecular investigations in animal models.
When studying CHRM1 in experimental systems, researchers should consider the following methodological approaches:
Antibody Selection: Use recombinant polyclonal antibodies that offer the sensitivity of polyclonal antibodies with the specificity of monoclonal antibodies. These antibodies provide consistent detection across experiments, circumventing the biological variability typically associated with traditional polyclonal antibody production .
Application-Specific Considerations:
For Western Blot: Use antibodies at appropriate concentrations (e.g., 0.3 μg/mL) and prepare brain lysates in RIPA buffer. Note that while the predicted band size is 51 kDa, the observed band may appear at 48 kDa .
For Immunocytochemistry: Validate antibody specificity with appropriate controls and consider co-staining with cell-type-specific markers, especially when investigating neuronal subpopulations .
Species Considerations: Verify antibody cross-reactivity with your species of interest. For example, some CHRM1 antibodies are predicted to react with monkey, pig, house, and rat samples , while others may have different specificities.
Recombinant Protein Work: When working with recombinant pig CHRM1, ensure proper validation of protein functionality through binding assays or functional tests appropriate to the experimental context .
Studying CHRM1-mediated signaling cascades requires multi-faceted approaches:
G-Protein Coupling Analysis: Since CHRM1 can couple with different G proteins (Gq, Gi, Gs), researchers should use specific inhibitors to distinguish between pathways:
For Gq-mediated signaling: Monitor phospholipase C activation and subsequent inositol trisphosphate production.
For Gs-mediated signaling: Measure cAMP production, which would be susceptible to cholera toxin (CTX).
For Gi-mediated signaling: Assess inhibition of adenylyl cyclase, which would be susceptible to pertussis toxin (PTX) .
Calcium Imaging: Given that CHRM1 activation leads to calcium release from the endoplasmic reticulum, calcium imaging techniques can provide valuable insights into receptor activation and downstream signaling dynamics .
Mitochondrial Function Assays: To investigate CHRM1's effect on mitochondrial function, researchers should:
Electrophysiological Approaches: Since CHRM1 mediates slow EPSPs in autonomic ganglia, electrophysiological recordings can provide direct functional readouts of receptor activity in neuronal systems .
Based on recent research findings, the following specialized techniques are recommended for investigating CHRM1's role in mitochondrial function:
Contradictory findings in CHRM1 research often stem from species differences, methodological variations, or context-dependent effects. Researchers can reconcile these contradictions through:
Several emerging areas of CHRM1 research hold promise for therapeutic applications:
Alzheimer's Disease Intervention: The correlation between CHRM1 loss and poor outcomes in AD patients suggests that preserving or enhancing CHRM1 function could be neuroprotective. Research focusing on compounds that selectively enhance CHRM1 signaling or expression could yield novel therapeutic strategies .
Mitochondrial Function Enhancement: The discovery that CHRM1 affects mitochondrial respiration, ATP synthase oligomerization, and respirasome assembly opens avenues for targeting energy metabolism in neurological disorders. Therapeutic approaches that preserve these CHRM1-dependent mitochondrial functions could potentially mitigate neurodegeneration .
Cognitive Enhancement: Given CHRM1's role in cognitive flexibility, synaptic plasticity modulation, and working memory , targeted modulation of this receptor could address cognitive deficits in various neurological conditions beyond AD.
Dark Neuron Pathology: The significant increase in dark neurons observed in Chrm1-/- cortices represents a novel pathological phenomenon that merits further investigation. Understanding the mechanism and significance of this alteration could reveal new aspects of neuronal vulnerability in disease states .
Advances in recombinant protein technology offer several opportunities to enhance CHRM1 research:
Improved Antibody Development: Recombinant polyclonal antibodies, such as those comprising multiple different recombinant monoclonal antibodies, provide higher detection sensitivity for low-abundance targets while maintaining specificity and batch-to-batch consistency . Further refinements in this technology could yield even more precise tools for CHRM1 detection.
Structure-Function Studies: Production of full-length and partial recombinant CHRM1 proteins enables detailed structure-function analyses through techniques such as X-ray crystallography or cryo-electron microscopy, potentially revealing novel binding sites for drug development.
Functional Reconstitution: Incorporating recombinant CHRM1 into artificial membrane systems or cell lines lacking endogenous muscarinic receptors allows precise control over receptor density, coupling partners, and environmental conditions, facilitating mechanistic studies of receptor function.
Cross-Species Comparative Research: The ability to produce recombinant CHRM1 from different species (e.g., pig, human, rat) enables direct comparative studies to better understand species-specific differences in receptor function that may impact translational research .