Recombinant Pig Muscarinic acetylcholine receptor M3 (CHRM3)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant Pig CHRM3 is produced using multiple expression platforms, each offering distinct advantages:

Expression SystemProduct CodeSourceTag
E. coli (prokaryotic)CSB-CF005383PIIn vitro E. coli expressionN-terminal His
YeastCSB-YP005383PI1Pichia pastorisPartial sequence
Baculovirus (insect cells)CSB-BP005383PI1Insect cell linesPartial sequence
Mammalian cellsCSB-MP005383PI1HEK293 or CHO cellsPartial sequence

Data compiled from .

  • E. coli: Most cost-effective for large-scale production but may lack post-translational modifications.

  • Mammalian cells: Preserve native-like glycosylation and folding, critical for functional assays .

Purification and Validation

  • Purification: Typically uses immobilized metal affinity chromatography (IMAC) for His-tagged proteins .

  • Validation: SDS-PAGE, Western blot, and functional assays (e.g., Gq/11 coupling activity) confirm integrity .

Signaling Mechanisms

  • Primary Pathway: Binds acetylcholine to activate Gq/11 proteins, triggering phospholipase C (PLC)-mediated hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP₂) into inositol triphosphate (IP₃) and diacylglycerol (DAG) .

  • Downstream Effects:

    • IP₃-induced calcium release from intracellular stores.

    • DAG-activated protein kinase C (PKC), modulating ion channels and enzyme activity .

Physiological Roles in Pigs

  • Smooth Muscle Regulation: Mediates contraction in gastrointestinal and urinary tract smooth muscle .

  • Secretory Functions: Stimulates salivary, pancreatic, and bronchial gland secretion .

Pharmacological Studies

  • Used to screen M3-specific agonists/antagonists for treating overactive bladder, asthma, or gastrointestinal dysmotility .

  • Example: Testing the efficacy of anticholinergics like darifenacin .

Disease Modeling

  • Prune Belly Syndrome: Linked to CHRM3 mutations in humans; recombinant pig CHRM3 aids in studying developmental bladder malformations .

  • Pancreatitis: M3 receptor hyperactivation in acinar cells induces inflammation, modeling human pancreatic disorders .

Challenges and Considerations

  • Post-Translational Modifications: Mammalian systems are preferred for studies requiring native glycosylation patterns .

  • Stability: Recombinant proteins require storage at -80°C with cryoprotectants (e.g., glycerol) to prevent aggregation .

Future Directions

  • Gene-Editing Models: CRISPR-modified pigs expressing humanized CHRM3 for translational research .

  • Biased Agonism: Developing ligands that selectively activate G protein vs. β-arrestin pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its implementation.
Synonyms
CHRM3; Muscarinic acetylcholine receptor M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MTLHNNNTTSPLFPNISSSWIHGPSDAGLPPGTVTHFGSYNISQAAGNFSSPNGTTSDPL GGHTIWQVVFIAFLTGILALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSL KRSARRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGTVDLERKASKLQAQKSMDDGGSF QKSFSKLPIQLESAVDTAKASDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. Its primary transducing effect is Pi turnover.
Gene References Into Functions
  1. Data suggest that both M(2) and M(3) muscarinic receptors mediate contraction in both pig clasp and sling fibers, similar to human clasp and sling fibers. PMID: 20133950
  2. Expression and function of M2 and M3 receptors are similar in the detrusor of juvenile and mature pigs. PMID: 18157728
  3. M2 and M3 receptors are upregulated in a time-dependent and pressure-dependent manner after as little as a 24 h exposure to increased hydrostatic pressure in the bladder. PMID: 18563417
Database Links

KEGG: ssc:100144478

UniGene: Ssc.102307

Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of pig CHRM3?

Pig CHRM3 is a G protein-coupled receptor that mediates cellular responses through the activation of Gq/11 proteins upon acetylcholine binding. The receptor contains multiple potential glycosylation sites which may explain its migration at a higher molecular weight than predicted in techniques like Western blotting . Functionally, CHRM3 promotes the breakdown of phosphoinositides and modulates potassium channels, with its primary transducing effect being phosphoinositide turnover . The receptor is expressed in smooth muscle, heart tissue, and secretory glands, where it regulates physiological processes including gastrointestinal peristalsis, glandular secretion, cardiac rhythm, and vasodilation .

How does pig CHRM3 compare structurally to human CHRM3?

While the search results don't provide specific sequence homology data between pig and human CHRM3, G protein-coupled receptors like CHRM3 tend to be highly conserved across mammalian species. This conservation is particularly evident in functional domains such as the ligand-binding site and G protein interaction regions. Researchers should note that pigs have been suggested as valuable experimental models for studying human immune responses, particularly for influenza , suggesting sufficient homology for translational research. When working with antibodies against CHRM3, cross-reactivity between species should be carefully evaluated, as some commercial antibodies may work across multiple species due to strong homology .

What expression systems are most effective for producing recombinant pig CHRM3?

For successful expression of recombinant pig CHRM3, mammalian expression systems are generally preferred over bacterial systems due to the need for post-translational modifications, particularly glycosylation. HEK293 and CHO cell lines have been successfully used for expressing GPCRs including muscarinic receptors. When designing expression constructs, researchers should consider incorporating purification tags that won't interfere with receptor function. For functional studies, NanoLuc Binary Technology-based cell systems have been employed to study CHRM3-Gq coupling dynamics , suggesting this could be an effective approach for pig CHRM3 as well.

What antibodies are available for detecting recombinant pig CHRM3?

Several validated antibodies have been developed for CHRM3 detection, though specific validation for pig CHRM3 may vary. Commercial options include rabbit polyclonal antibodies that have been validated for techniques such as Western blotting and immunohistochemistry . When selecting antibodies, researchers should consider the specific application needs and whether cross-reactivity with pig CHRM3 has been confirmed. For immunohistochemistry applications, antibodies have been successfully used with paraffin-embedded tissues after antigen retrieval in citrate buffer (pH 6.0) . When working with recombinant pig CHRM3, validation of antibody specificity is crucial, particularly if the recombinant protein contains tags or modifications.

What methodologies are most effective for studying the dynamic interactions between recombinant pig CHRM3 and G proteins?

For investigating CHRM3-G protein interactions, hydrogen-deuterium exchange mass spectrometry (HDX-MS) has proven effective for elucidating the molecular mechanisms of receptor-G protein coupling . This technique allows researchers to study the full-length wild-type receptor interacting with G proteins under more physiologically relevant conditions. Additionally, NanoLuc Binary Technology-based cell systems provide valuable tools for examining these interactions in cellular contexts .

For pig-specific studies, researchers should consider:

  • Setting up cell-based assays measuring downstream signaling events (calcium mobilization, inositol phosphate accumulation)

  • Using BRET/FRET techniques to monitor real-time interactions

  • Employing immunoprecipitation followed by mass spectrometry to identify interaction partners

The analysis of CHRM3-Gq coupling should examine both well-defined binding interfaces and previously neglected regions. Recent research has indicated that the intracellular loop 3 (ICL3) of CHRM3 negatively affects M3-Gq coupling, while the Gαq α-helical domain undergoes unique conformational changes during coupling .

How can researchers effectively address the challenges of expressing and purifying the intracellular loop 3 (ICL3) of pig CHRM3?

The intracellular loop 3 (ICL3) of CHRM3 presents significant challenges for expression and purification due to its size and potentially disordered structure. Research indicates that this region negatively affects M3-Gq coupling , making it an important target for structure-function studies.

Recommended methodological approaches include:

  • Expression strategies: Use fusion protein systems (MBP, GST, or SUMO tags) to enhance solubility

  • Purification protocol: Implement a two-step purification process involving affinity chromatography followed by size exclusion

  • Structural stabilization: Consider co-expression with interaction partners or antibody fragments

  • Analysis techniques: Employ circular dichroism and NMR for structural characterization of this potentially disordered region

When designing constructs, researchers should consider that modifications in the ICL3 region may significantly impact receptor function and G protein coupling dynamics, which should be experimentally verified.

What are the best experimental approaches for investigating pig CHRM3's role in immune response regulation?

Given the emerging evidence connecting cholinergic signaling to immune function and the value of pig models in studying human immune responses , investigating pig CHRM3's role in immune regulation requires multifaceted approaches:

  • Single B cell transcriptomics: This approach has been successfully used to study pig B cell repertoire and could be adapted to assess CHRM3 expression and function in immune cells

  • Phylogenetic analysis: Analyzing CDR3 sequences across germline families can reveal immune response patterns potentially regulated by cholinergic signaling

  • In vivo challenge models: Challenge studies with antigens like chimeric PRRSV can help identify CHRM3-dependent immune responses

  • Secretory gland analysis: Given CHRM3's role in exocrine gland regulation and potential involvement in conditions like Sjögren's syndrome , examining salivary and lacrimal gland function in relation to CHRM3 signaling could provide valuable insights

These approaches should be integrated with standard immunological assays to comprehensively characterize the receptor's immunomodulatory functions.

What are the latest techniques for studying the role of pig CHRM3 in cardiovascular regulation and hypertension?

Recent research has established connections between CHRM3 genetic variations and salt sensitivity, longitudinal blood pressure changes, and hypertension development . For investigating pig CHRM3's cardiovascular roles, researchers should consider:

  • Genetic association studies: Single nucleotide polymorphisms (SNPs) like rs10802811 within the CHRM3 gene have been linked to hypertension in human studies

  • Controlled salt intervention experiments: Following methodologies from human studies, researchers can implement carefully controlled dietary salt interventions to investigate the relationship between CHRM3 function and salt-induced changes in blood pressure

  • Long-term monitoring: Longitudinal studies evaluating blood pressure progression and cardiovascular outcomes in relation to CHRM3 expression and function provide valuable insights

  • Ex vivo tissue studies: Using pig cardiac and vascular tissues to evaluate CHRM3-mediated responses under various conditions

These approaches should be complemented with molecular and cellular assays to understand the underlying mechanisms.

How can researchers effectively study the potential role of pig CHRM3 in pathological conditions?

CHRM3 has been implicated in various pathological conditions including cancer, specifically showing elevated expression in recurrent glioblastoma compared to primary tumors . For studying pig CHRM3 in disease contexts, researchers should consider:

Methodological approach for oncology studies:

  • Knockdown/knockout studies using siRNA or CRISPR-Cas9 to assess the impact on cell growth and invasion

  • Orthotopic animal models to evaluate in vivo effects of CHRM3 modulation on disease progression and survival

  • Transcriptome analysis to identify downstream effectors, such as matrix metalloproteinases (MMPs) and chemokines that may be regulated by CHRM3

For inflammatory and autoimmune conditions:

  • Study CHRM3 expression in affected tissues using immunohistochemistry with proper controls

  • Investigate the relationship between CHRM3 and secretory gland dysfunction in conditions like Sjögren's syndrome

  • Evaluate the effects of CHRM3-selective agonists and antagonists on disease parameters

These approaches should be tailored to the specific pathological condition under investigation while maintaining rigorous experimental controls.

What are the critical quality control parameters for recombinant pig CHRM3 production?

When producing recombinant pig CHRM3, researchers should implement comprehensive quality control measures:

  • Purity assessment: SDS-PAGE analysis with appropriate enrichment gel (5%) and separation gel (15%) to account for the glycosylated nature of CHRM3

  • Functional validation: Receptor binding assays using known muscarinic ligands to confirm proper folding

  • Glycosylation analysis: Verification of post-translational modifications, particularly important since CHRM3 contains multiple potential glycosylation sites that affect its apparent molecular weight

  • Aggregation monitoring: Size exclusion chromatography to assess the monodispersity of the purified protein

  • Endotoxin testing: Critical for preparations intended for in vivo or primary cell studies

Additionally, researchers should verify receptor activity through downstream signaling assays measuring calcium mobilization or phosphoinositide turnover.

How can researchers optimize experimental designs to study pig CHRM3 in comparative immunology?

Given the established value of pigs as experimental models for human immune responses , researchers designing comparative immunology studies involving CHRM3 should consider:

  • Cross-species homology analysis: Begin with detailed sequence alignment of CHRM3 across species to identify conserved and divergent regions

  • Convergent antibody evolution: Implement techniques to identify examples of convergent antibody evolution across different starting points, such as domestic farm pigs and experimental models

  • Phylogenetic tree construction: Use libraries of CDR3 sequences derived from individual enriched germline families to assess phylogenetic relationships

  • Challenge models: Develop appropriate antigen challenge systems that can reveal CHRM3-dependent immune responses across species

This approach allows researchers to identify conserved immune response mechanisms regulated by CHRM3 that may have translational relevance to human health.

What statistical approaches are most appropriate for analyzing CHRM3 functional data across multiple experimental systems?

When analyzing functional data for recombinant pig CHRM3 across different experimental systems, researchers should employ rigorous statistical approaches:

  • For dose-response experiments: Use non-linear regression to determine EC50/IC50 values, with comparison across systems using extra sum-of-squares F tests

  • For time-course studies: Apply repeated measures ANOVA with appropriate post-hoc tests

  • For comparing receptor variants: Implement multivariate analysis techniques to account for multiple parameters simultaneously

  • For complex interaction studies: Consider Bayesian statistical approaches particularly for G protein coupling dynamics

When integrating data from different experimental platforms (e.g., binding assays, functional readouts, structural studies), researchers should normalize results appropriately and consider developing integrated mathematical models to comprehensively understand receptor function.

How should researchers approach contradictory findings in CHRM3 signaling studies?

When encountering contradictory findings in CHRM3 signaling studies, researchers should systematically evaluate:

  • Experimental context differences: Carefully analyze divergences in cell types, expression levels, and assay conditions that might explain contradictory results

  • Receptor modifications: Assess whether tags, mutations, or expression systems might differentially impact receptor function

  • Temporal dynamics: Consider that signaling observations at different time points might reveal distinct aspects of receptor function

  • Biased signaling: Evaluate whether ligands might preferentially activate different downstream pathways

  • Interaction partners: Investigate whether cellular background differences in G proteins, arrestins, or other signaling components could explain discrepancies

For resolving contradictions, implement orthogonal methods to verify key findings and consider developing unified models that incorporate apparently contradictory observations into a coherent mechanistic framework.

What emerging technologies might advance our understanding of pig CHRM3 structure-function relationships?

Several cutting-edge technologies show promise for advancing pig CHRM3 research:

  • Cryo-electron microscopy: Recent advances enable high-resolution structural determination of membrane proteins like GPCRs in various conformational states

  • Nanobody development: Pig-specific nanobodies could stabilize CHRM3 conformations for structural studies and serve as selective pharmacological tools

  • AlphaFold2 and structure prediction: Computational approaches can predict structures of poorly characterized regions like ICL3 and guide experimental design

  • Single-molecule FRET: These techniques can reveal dynamic conformational changes during receptor activation and signaling

  • Spatial transcriptomics: May uncover tissue-specific CHRM3 expression patterns relevant to physiological function

Integration of these approaches with traditional methods will likely yield comprehensive insights into pig CHRM3 structure-function relationships.

How might pig CHRM3 research inform translational applications in human health?

Pig CHRM3 research has several potential translational applications:

  • Drug discovery: Pigs represent valuable preclinical models for testing CHRM3-targeted therapeutics for conditions like overactive bladder, COPD, and potentially Sjögren's syndrome

  • Biomarker development: Research on CHRM3 genetic variations associated with hypertension could lead to diagnostic markers for salt sensitivity and cardiovascular risk

  • Cancer therapeutics: Understanding CHRM3's role in conditions like glioblastoma progression could identify novel therapeutic targets, as CHRM3 knockdown has been shown to inhibit cancer cell growth and invasion

  • Immune modulation: Insights from pig models regarding CHRM3's influence on immune responses could inform therapeutic approaches for inflammatory and autoimmune conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.