Recombinant Pig NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6) is a protein subunit of the NADH:ubiquinone oxidoreductase, also known as Complex I, which is the first enzyme complex of the mitochondrial electron transport chain . This chain is essential for transferring electrons from NADH to molecular oxygen during oxidative phosphorylation . NDUFB6 participates in NADH dehydrogenase activity and oxidoreductase activity and is involved in transferring electrons to the respiratory chain . Complex I inhibitors have garnered interest as potential biological probes, insecticides, and chemotherapeutic agents .

Gene and Protein Characteristics

The human gene that encodes NDUFB6 is located on chromosome 2 . Research indicates that genetic, epigenetic, and non-genetic factors are associated with NDUFB6 expression in human muscle tissue .

Role in Physical Activity and Insulin Sensitivity

NDUFB6 polymorphisms can modulate responses to exercise in individuals with type 2 diabetes . The NDUFB6 rs540467 single nucleotide polymorphism (SNP) influences how physical activity (PA) affects insulin sensitivity, body composition, and liver fat in type 2 diabetes patients . People with type 2 diabetes who have the G/G genotype of the NDUFB6 SNP rs540467 show a positive correlation between changes in their mid-value and physical activity levels. Those with the A-allele do not show the same association .

In vitro studies have demonstrated that reduced NDUFB6 expression leads to decreased mitochondrial respiration . In C2C12 myotubes, Ndufb6 silencing decreased complex I-linked state u respiration by 36% in the absence of electric pulse stimulation (EPS)-induced contractions . Furthermore, while EPS-induced contractions increased complex I-linked respiration in control myotubes, this effect was not observed in Ndufb6-silenced myotubes .

NDUFB6 and Disease

Changes in NDUFB6 expression have been linked to age and type 2 diabetes . Lower levels of NDUFB6 mRNA and protein have been observed in muscles of older individuals or those with type 2 diabetes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
NDUFB6; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-128
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
SGYTPDEKLRLQQLRELRRRWLKDQELSPREPLLPPRRVWPMEQFWNKFLQDGAPWKNVI YKTYRHSIFAVTHVLIPVWIIHYYLKYHVTAKPYTVVERKPRIFPGDTILXTGEVIPLIE GFPXQPS
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFB6 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the function of NDUFB6 in mitochondrial respiration?

NDUFB6 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6) serves as a critical accessory subunit of Complex I in the mitochondrial respiratory chain. It plays an essential role in maintaining the structural integrity of Complex I and facilitating electron transfer from NADH to ubiquinone. Functionally, NDUFB6 contributes to Complex I-linked state u respiration, as demonstrated in studies where silencing NDUFB6 decreased this activity by approximately 36% . The protein does not directly participate in electron transfer flavoprotein complex (CETF)-linked respiration, suggesting its specificity to Complex I function rather than affecting other aspects of mitochondrial respiration .

Methodologically, researchers can assess NDUFB6 function through high-resolution respirometry measurements in isolated mitochondria or permeabilized cells. Parameters to evaluate include:

Respiratory ParameterDescriptionTypical Effect of NDUFB6 Deficiency
Complex I-linked state u respirationMaximum electron transport capacity through Complex IDecreased by ~36%
CETF-linked respirationFatty acid oxidation capacityGenerally unaffected
Respiratory Control Ratio (RCR)Indicator of mitochondrial coupling efficiencyMinimal direct effect
Leak Control Ratio (LCR)Indicator of proton leak across membraneMinimal direct effect

What is the tissue expression pattern of NDUFB6 in porcine models?

While the search results don't provide specific data on porcine NDUFB6 expression patterns, we can extrapolate from related species data. NDUFB6 is primarily expressed in tissues with high metabolic activity and mitochondrial content. Based on antibody testing data, NDUFB6 shows high expression in skeletal muscle tissue in mice and rats .

For porcine studies, researchers should evaluate expression using similar methodologies:

  • Western Blot analysis using validated antibodies (typical dilutions of 1:1000-1:4000)

  • Immunohistochemistry on tissue sections (recommended dilutions of 1:50-1:500)

  • qRT-PCR for mRNA expression analysis

When comparing across tissues, researchers should standardize to appropriate housekeeping genes or proteins (such as GAPDH for Western blotting) to accurately represent relative expression levels.

What are the recommended protocols for producing recombinant pig NDUFB6 protein?

Production of recombinant pig NDUFB6 requires careful optimization of expression systems and purification strategies. Based on protocols used for other mammalian NDUFB6 proteins, the following methodological approach is recommended:

  • Expression System Selection: Mammalian expression systems such as HEK293 cells are preferred for optimal post-translational modifications and proper folding . While bacterial systems might yield higher protein quantities, they often produce less functionally relevant protein.

  • Vector Design:

    • Include a species-optimized codon sequence for the pig NDUFB6 gene

    • Incorporate an appropriate affinity tag (His, FLAG, or GST) for purification

    • Consider a cleavable tag if the native protein is required for functional studies

  • Transfection and Expression:

    • Utilize lipid-based transfection for transient expression or establish stable cell lines for consistent production

    • Culture cells at 37°C with 5% CO₂ in appropriate growth medium

    • Induce expression as needed depending on the promoter system

  • Purification Strategy:

    • Lyse cells under conditions that maintain protein stability (typically PBS-based buffers)

    • Perform affinity chromatography using the incorporated tag

    • Consider size exclusion chromatography as a secondary purification step

    • Store in PBS buffer at 2-8°C for short-term or with glycerol at -80°C for long-term storage

For coupling to magnetic beads (if needed for pull-down experiments):

  • Use beads with hydrophilic surface characteristics

  • Aim for particle size of approximately 2 μm for optimal surface area

  • Target binding capacity of >200 pmol protein per mg beads

What detection methods are most effective for studying NDUFB6 in porcine tissue samples?

Detection of NDUFB6 in porcine tissues requires appropriate antibody selection and optimization of protocols. Based on available data, the following methodological approaches are recommended:

  • Western Blot Analysis:

    • Sample preparation: Homogenize tissue in RIPA buffer with protease inhibitors

    • Protein loading: 20-40 μg total protein per lane

    • Separation: 12-15% SDS-PAGE (NDUFB6 is approximately 17 kDa)

    • Transfer: PVDF membrane recommended over nitrocellulose

    • Blocking: 5% non-fat milk or BSA in TBST (1 hour, room temperature)

    • Primary antibody: Validated antibodies at 1:1000-1:4000 dilution

    • Detection: HRP-conjugated secondary antibodies with ECL substrate

    • Controls: Include positive control samples (e.g., skeletal muscle)

  • Immunohistochemistry:

    • Fixation: 10% neutral buffered formalin

    • Antigen retrieval: TE buffer pH 9.0 (preferred) or citrate buffer pH 6.0

    • Blocking: 5-10% normal serum from secondary antibody host species

    • Primary antibody: 1:50-1:500 dilution, overnight at 4°C

    • Detection: HRP-polymer detection system with DAB chromogen

    • Counterstain: Hematoxylin for nuclear visualization

  • Immunofluorescence:

    • Similar preparation to IHC but using fluorophore-conjugated secondary antibodies

    • Include DAPI nuclear counterstain

    • Use confocal microscopy for co-localization with mitochondrial markers

Detection MethodPrimary Antibody DilutionIncubation ConditionsNotes
Western Blot1:1000-1:4000Overnight at 4°CInclude muscle tissue as positive control
IHC1:50-1:500Overnight at 4°CUse TE buffer pH 9.0 for antigen retrieval
IF1:100-1:500Overnight at 4°CCo-stain with mitochondrial markers

How can functional activity of NDUFB6 be assessed in experimental models?

Functional assessment of NDUFB6 requires techniques that evaluate its role in Complex I activity and mitochondrial respiration. Based on published methodologies, the following approaches are recommended:

  • High-Resolution Respirometry:

    • Preparation of isolated mitochondria or permeabilized cells

    • Measurement of oxygen consumption rates using instruments like Oroboros O2k

    • Assessment of Complex I-linked respiration using NADH-dependent substrates

    • Comparison of respiratory parameters with and without NDUFB6 knockdown or overexpression

  • Gene Silencing Approaches:

    • siRNA transfection targeting NDUFB6 (functional effects can be observed after 24h)

    • Evaluate at protein level via Western blot (typical knockdown efficiency of 40%)

    • Monitor changes in mitochondrial functional parameters:

      • Complex I-linked respiration

      • Response to contraction stimulation (EPS in cell culture models)

      • Insulin signaling pathway activity (e.g., Akt phosphorylation)

  • In Vitro Contraction Models:

    • Electric pulse stimulation (EPS) in myotube cultures to mimic exercise

    • Analysis of how NDUFB6 expression levels affect contraction-mediated improvements in mitochondrial function and insulin sensitivity

    • Assessment of rescue from palmitate-induced insulin resistance

  • Insulin Signaling Analysis:

    • Treatment with insulin followed by Western blot for phosphorylated Akt at Ser473

    • Comparison between normal and NDUFB6-deficient conditions

    • Evaluation of how NDUFB6 status affects palmitate-induced insulin resistance

How do polymorphisms in the NDUFB6 gene affect mitochondrial function and metabolism?

NDUFB6 genetic variations have significant impacts on mitochondrial function and metabolic responses, particularly in the context of physical activity and insulin sensitivity. Research has identified the rs540467 SNP as particularly important:

The rs540467 single nucleotide polymorphism (SNP) in the NDUFB6 gene demonstrates a clear gene-environment interaction that affects how individuals respond to physical activity. In patients with type 2 diabetes, carriers of different alleles show distinct responses:

  • G/G genotype carriers:

    • Show positive correlation between changes in insulin sensitivity (M-value) and physical activity levels

    • Exhibit decreased waist circumference with increasing physical activity (β=-1.52 ± 0.68, p=0.03)

    • Demonstrate reduced Fatty Liver Index (FLI) with increasing physical activity

    • Experience improved mitochondrial adaptation to exercise

  • A-allele carriers (G/A and A/A genotypes):

    • Show no significant association between physical activity and insulin sensitivity

    • Do not demonstrate improvements in waist circumference with physical activity

    • Show minimal changes in liver fat estimates despite increased physical activity

    • Exhibit impaired exercise-mediated improvements in muscle mitochondrial function

This polymorphism appears to be particularly relevant in individuals with type 2 diabetes, where approximately 36% of patients may be "non-responders" to physical activity regarding improvements in insulin sensitivity. The frequency of the A allele (associated with non-response) was 38% in non-responder groups compared to 22% in responder groups, though this difference did not reach statistical significance (p=0.12) .

The molecular mechanism appears to involve NDUFB6's role in Complex I-mediated mitochondrial respiration, which in turn affects insulin signaling pathways. When investigating cross-species applications, researchers should determine if the same polymorphism exists in porcine models and if it exerts similar effects.

What is the relationship between NDUFB6 expression and metabolic disease models?

NDUFB6 expression shows important relationships with metabolic conditions, particularly insulin resistance and type 2 diabetes. Research findings indicate:

  • Expression patterns in metabolic conditions:

    • Decreased NDUFB6 mRNA and protein levels occur in muscle of individuals with type 2 diabetes

    • Aging is also associated with reduced NDUFB6 expression in muscle tissue

    • These reductions correlate with impaired mitochondrial function and insulin resistance

  • Experimental evidence from cell models:

    • Silencing NDUFB6 in differentiated C2C12 myotubes reduces complex I-linked mitochondrial respiration by 36%

    • Control myotubes show increased complex I-linked respiration after electric pulse stimulation (EPS-induced contractions), while NDUFB6-silenced cells do not respond

    • NDUFB6 silencing prevents EPS-induced rescue from palmitate-induced insulin resistance

    • In control cells, EPS restored insulin-stimulated Akt phosphorylation after palmitate treatment

    • In NDUFB6-silenced cells, this beneficial effect was abolished, with 35% lower pAkt-Ser473 compared to control cells after EPS (0.64 ± 0.02 vs. 1.10 ± 0.05 AU; p<0.01)

  • Proposed mechanism:

    • NDUFB6 is essential for maintaining complex I function

    • Reduced NDUFB6 impairs mitochondrial respiration

    • This impairment prevents exercise-mediated improvements in insulin sensitivity

    • The mechanism creates a potential vicious cycle in type 2 diabetes, where reduced NDUFB6 levels contribute to insulin resistance, which may further impair mitochondrial function

This relationship suggests NDUFB6 as a potential therapeutic target or biomarker for metabolic conditions. For researchers working with porcine models of metabolic disease, monitoring NDUFB6 expression and function could provide valuable insights into disease mechanisms and potential interventions.

How do interspecies differences in NDUFB6 structure affect functional studies?

When working with porcine NDUFB6 in research, understanding interspecies differences is crucial for experimental design and data interpretation. While the search results don't provide specific information about pig NDUFB6 compared to other species, researchers should consider the following methodological approaches:

  • Sequence homology analysis:

    • Perform sequence alignment between pig NDUFB6 and other species (human, mouse, rhesus macaque)

    • Identify conserved domains essential for function versus variable regions

    • Special attention should be paid to regions containing known functional polymorphisms (such as rs540467 in humans)

  • Antibody cross-reactivity assessment:

    • Test antibodies validated for other species (such as the 16037-1-AP antibody) for cross-reactivity with pig NDUFB6

    • Perform Western blot validation using pig tissue samples alongside known positive controls

    • Optimize antibody dilutions specifically for pig samples (starting with recommended ranges of 1:1000-1:4000 for WB and 1:50-1:500 for IHC)

  • Functional conservation evaluation:

    • Compare the effects of NDUFB6 knockdown in cell lines from different species

    • Assess whether physiological responses (such as exercise adaptation) show similar NDUFB6 dependence across species

    • Determine if genetic variations like rs540467 SNP have functionally equivalent counterparts in pig NDUFB6

  • Expression system selection:

    • For recombinant protein production, consider species-specific post-translational modifications

    • Mammalian expression systems like HEK293 are generally preferred for structural integrity

    • Evaluate if the pig protein requires specific conditions for proper folding and function

Researchers should note that while protein function is often conserved, regulatory elements and response to environmental factors may differ between species. This is particularly important when translating findings from animal models to human applications or vice versa.

How can researchers address technical challenges in recombinant NDUFB6 production?

Production of recombinant NDUFB6 presents several technical challenges that researchers may encounter. Based on protein biochemistry principles and the available data, the following troubleshooting approaches are recommended:

  • Low protein yield issues:

    • Optimize codon usage for the expression system

    • Test different affinity tags (N-terminal vs. C-terminal)

    • Evaluate alternative expression systems (HEK293 shows good results for mammalian proteins)

    • Adjust culture conditions (temperature, induction timing, harvest time)

    • Consider using protease inhibitors throughout purification

  • Protein solubility problems:

    • Modify buffer composition (salt concentration, pH, detergents)

    • Test mild detergents for membrane-associated protein extraction

    • Use fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

    • Consider native purification versus denaturing/refolding approaches

  • Functional activity loss:

    • Verify protein folding via circular dichroism

    • Assess thermal stability through differential scanning fluorimetry

    • Test different storage buffers (PBS recommended based on available data)

    • Avoid repeated freeze-thaw cycles

    • Store at 2-8°C for short-term use rather than freezing

  • Protein aggregation during storage:

    • Use stabilizing agents (glycerol, sucrose, arginine)

    • Filter solutions before storage (0.22 μm)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Verify protein stability periodically (expected stability >6 months under proper storage)

IssueCommon CausesTroubleshooting ApproachRecommended Solution
Low yieldPoor expression, inefficient purificationExpression system optimizationSwitch to HEK293 system
InsolubilityHydrophobic regions, misfoldingBuffer composition adjustmentAdd mild detergents, modify salt concentration
Activity lossDenaturation, aggregationStorage condition optimizationStore at 2-8°C in PBS buffer
AggregationImproper buffer, freeze-thawStabilizing agents additionAdd 5-10% glycerol, avoid freezing

How should conflicting experimental results in NDUFB6 functional studies be interpreted?

When encountering conflicting results in NDUFB6 functional studies, researchers should systematically evaluate several factors that might explain the discrepancies:

  • Genetic variation considerations:

    • Check for SNP variations in the NDUFB6 gene of experimental models

    • The rs540467 SNP significantly affects response to physical activity in humans, with G/G genotype showing positive correlations between physical activity and insulin sensitivity, while A-allele carriers do not

    • Similar genetic variations may exist in animal models and cell lines that could explain differential responses

  • Methodological differences analysis:

    • Evaluate differences in knockdown efficiency between studies (typical efficient knockdown shows ~40% reduction)

    • Compare respirometry protocols and substrate conditions

    • Assess differences in EPS parameters for contraction simulation

    • Consider variations in insulin resistance induction protocols (palmitate concentration and exposure time)

  • Cell/tissue type variations:

    • Different tissues show varied NDUFB6 expression levels (skeletal muscle typically shows high expression)

    • Cell lines may have different baseline mitochondrial capacity

    • Primary cells versus immortalized lines may respond differently

    • Species differences may affect functional outcomes

  • Environmental factor interactions:

    • Exercise/contraction intensity and duration affects outcomes

    • Presence of fatty acids influences insulin sensitivity measurements

    • Glucose availability alters metabolic signaling responses

    • Differentiation state of myocytes impacts NDUFB6 expression and function (maximal expression typically from day 4 of differentiation)

When interpreting conflicting results, researchers should consider constructing a comprehensive model that incorporates genetic, methodological, tissue-specific, and environmental variables to explain observed differences. This approach can transform apparently conflicting findings into a more nuanced understanding of context-dependent NDUFB6 function.

What are the critical considerations for translating NDUFB6 findings between in vitro models and in vivo systems?

Translating findings about NDUFB6 between in vitro experiments and in vivo systems requires careful consideration of several factors that influence experimental outcomes and physiological relevance:

By carefully accounting for these factors, researchers can develop more effective translational strategies that improve the predictive value of in vitro findings for in vivo outcomes, and better apply animal model findings to human health and disease.

How can NDUFB6 be targeted for potential therapeutic applications in metabolic disorders?

Given NDUFB6's role in mitochondrial function and its association with insulin sensitivity, several potential therapeutic approaches could be developed:

  • Gene therapy approaches:

    • Delivery of functional NDUFB6 gene to overcome genetic variants associated with metabolic dysfunction

    • Targeted enhancement of NDUFB6 expression in skeletal muscle to improve mitochondrial function

    • CRISPR-based correction of deleterious SNPs like rs540467

    • Methodological considerations include tissue-specific delivery systems and expression control

  • Small molecule modulators:

    • Screening for compounds that enhance NDUFB6 stability or activity

    • Development of drugs that bypass NDUFB6 dysfunction by acting on downstream pathways

    • Identification of molecules that specifically enhance Complex I activity

    • Testing in cell-based models using assays for mitochondrial respiration and insulin signaling

  • Exercise mimetics:

    • Development of compounds that simulate the beneficial effects of exercise on NDUFB6 function

    • Target identification for drugs that can overcome the exercise non-response phenotype seen in carriers of specific SNPs

    • Testing protocols should include assessment of effects on EPS-induced improvements in insulin sensitivity

  • Personalized intervention strategies:

    • Genetic screening for NDUFB6 variants to identify likely responders to exercise intervention

    • Tailored exercise regimens based on NDUFB6 genotype (rs540467 G/G carriers may benefit more from conventional exercise)

    • Alternative interventions for non-responders (A-allele carriers)

    • Clinical trial design should incorporate genotype stratification for more precise outcome assessment

Research in this area should focus on understanding the molecular mechanisms by which NDUFB6 variants affect mitochondrial function and insulin sensitivity, as this will inform more targeted therapeutic approaches. Combination therapies that address both NDUFB6 function and related metabolic pathways may prove most effective.

What novel methodological approaches can advance the study of NDUFB6 in complex metabolic systems?

Advancing NDUFB6 research requires integration of innovative methodologies that can capture its role in complex metabolic networks:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize NDUFB6 localization within mitochondrial structures

    • Live-cell imaging with fluorescently tagged NDUFB6 to track dynamic changes during metabolic challenges

    • Correlative light and electron microscopy to link NDUFB6 distribution with ultrastructural features

    • Implementation protocols should include appropriate controls for tag interference with function

  • Multi-omics integration approaches:

    • Proteomics to identify NDUFB6 interaction partners under different metabolic conditions

    • Metabolomics to map metabolic changes associated with NDUFB6 variants or expression levels

    • Transcriptomics to understand regulatory networks controlling NDUFB6 expression

    • Bioinformatic pipelines to integrate these datasets into comprehensive metabolic models

  • Tissue-on-chip and organoid technologies:

    • Development of microphysiological systems incorporating skeletal muscle cells with varying NDUFB6 genotypes

    • Multi-tissue chips connecting muscle, liver, and adipose models to study systemic effects

    • Implementation of exercise-mimetic stimulation in these systems

    • Validation protocols comparing chip/organoid findings to animal models and human data

  • In situ genetic manipulation techniques:

    • CRISPR-Cas9 editing to introduce or correct NDUFB6 variants in relevant cell types

    • Inducible expression systems to study temporal aspects of NDUFB6 function

    • Tissue-specific knockout models to evaluate organ-specific roles

    • Methodological considerations include off-target effect assessment and efficiency verification

  • Real-time metabolic monitoring:

    • Development of biosensors for continuous monitoring of Complex I activity

    • Implementation of microfluidic systems for real-time assessment of cellular responses to metabolic challenges

    • Integration with contraction models to simultaneously measure exercise response and metabolic adaptation

    • Calibration protocols to ensure consistent measurements across experimental systems

These advanced methodologies, when applied to NDUFB6 research, can provide unprecedented insights into its role in metabolic health and disease, potentially revealing new therapeutic targets and personalized intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.