Recombinant Pig NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate your preferences in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Please note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MPLVYMNIIMAFAIALAGLLMYRSHLMSSLLCLEGMMLSLFIMSTLIILNTHFTLANMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is an essential subunit of mitochondrial respiratory complex I, which plays a crucial role in the initial steps of the oxidative phosphorylation pathway. This protein is encoded by the mitochondrial genome (mtDNA) and functions in electron transfer from NADH to ubiquinone, coupled with proton pumping across the inner mitochondrial membrane. The small hydrophobic MT-ND4L protein contributes to the membrane domain of complex I and is critical for maintaining proper complex assembly and function .

The protein's general structure is characterized by transmembrane helices, with the porcine variant showing sequence conservation with other mammalian species but containing species-specific residues that may affect functional efficiency. Alterations in this protein have been associated with various pathological conditions, including neurodegenerative disorders and metabolic diseases, highlighting its importance in cellular energy production .

How should researchers approach sequence verification for recombinant pig MT-ND4L?

Verification of recombinant pig MT-ND4L sequence should employ a multi-step process:

  • DNA Sequencing: Following cloning, perform bidirectional Sanger sequencing of the entire construct to confirm the correct sequence.

  • Mass Spectrometry Validation: After expression, analyze the purified protein using LC-MS/MS to verify the amino acid sequence and post-translational modifications.

  • Sequence Alignment Analysis: Compare the obtained sequence with reference databases using tools like BLAST to confirm species specificity and detect any mutations.

  • Coverage Assessment: Ensure complete coverage of the sequence, as certain regions of MT genes may be challenging to sequence accurately due to their high AT content or secondary structures .

When analyzing sequence data, researchers should pay particular attention to regions that tend to accumulate variants, as observed in human MT-ND4L studies where specific mutations like rs28709356 C>T have been associated with disease states .

What are the key differences between pig MT-ND4L and human MT-ND4L?

While both proteins serve similar functions in complex I, several notable differences exist:

These differences, while subtle, may impact how the protein interacts within complex I and responds to physiological stress, making comparative studies valuable for both basic research and translational applications.

What expression systems are most effective for recombinant pig MT-ND4L production?

Based on current research practices with similar mitochondrial proteins, recommended expression systems include:

E. coli Expression System:

  • Most commonly used for initial studies due to high yield and simplicity

  • Recommended strain: BL21(DE3) with pET vector systems

  • Expression conditions: Induction with 0.5-1.0 mM IPTG at 18°C for 16-20 hours to minimize inclusion body formation

  • Challenges: May require optimization to address hydrophobicity and proper folding

Mammalian Expression Systems:

  • HEK293 or CHO cells provide better post-translational modifications

  • More suitable for functional studies requiring proper protein folding

  • Typically lower yield but higher biological relevance

Cell-Free Expression Systems:

  • Useful for difficult-to-express hydrophobic proteins

  • Allows direct incorporation of detergents during synthesis

  • Provides rapid production for initial characterization studies

Each system offers distinct advantages, with E. coli being preferred for structural studies requiring high protein quantities, while mammalian systems are better suited for functional assays where proper folding and post-translational modifications are critical .

What purification strategies work best for recombinant pig MT-ND4L?

Purification of MT-ND4L presents challenges due to its hydrophobic nature and tendency to aggregate. A recommended multi-step purification protocol includes:

  • Affinity Chromatography:

    • For His-tagged constructs, use Ni-NTA resin with carefully optimized imidazole concentrations

    • Include 0.1-1% mild detergent (DDM, LMNG, or digitonin) in all buffers

    • Perform binding at 4°C with extended incubation times (2-4 hours)

  • Size Exclusion Chromatography:

    • Critical for removing aggregates and ensuring monodispersity

    • Use Superdex 75 or 200 columns with detergent-containing running buffer

    • Analyze elution profile carefully to identify properly folded protein fractions

  • Ion Exchange Chromatography (optional):

    • Can provide additional purity if needed

    • Select column type based on the protein's theoretical pI

Typical buffer compositions should maintain pH 7.4-8.0 with 150-300 mM NaCl, and include stabilizing agents such as glycerol (10-15%) throughout the purification process. Researchers should verify protein integrity through circular dichroism and thermal shift assays to confirm proper folding before proceeding to functional studies .

How can researchers assess the proper folding and activity of purified recombinant pig MT-ND4L?

Given the challenges in working with this hydrophobic protein, multiple complementary approaches should be employed:

Structural Integrity Assessment:

  • Circular Dichroism (CD) spectroscopy to confirm secondary structure elements

  • Thermal shift assays to determine protein stability and effects of buffer conditions

  • Limited proteolysis to verify proper folding through resistance to digestion patterns

Functional Validation:

  • NADH:ubiquinone oxidoreductase activity assays when incorporated into proteoliposomes

  • Measurement of NADH consumption rates using spectrophotometric methods

  • Membrane potential measurements using fluorescent probes to assess proton pumping

Integration Analysis:

  • Co-immunoprecipitation with other complex I subunits to verify interaction capabilities

  • Blue native PAGE to assess incorporation into complex I assemblies

  • Cryo-EM analysis of reconstituted complexes to verify structural integration

Researchers should establish baseline measurements using commercially available mitochondrial fractions as positive controls, and include appropriate negative controls such as denatured protein preparations or samples with specific inhibitors .

What techniques are most informative for studying the structure of pig MT-ND4L within complex I?

Several complementary techniques provide valuable structural insights:

Cryo-Electron Microscopy (Cryo-EM):

  • Currently the gold standard for complex I structural studies

  • Can achieve 2.5-3.1 Å resolution as demonstrated with bacterial Na+-NQR

  • Allows visualization of protein in its native membrane environment

  • Can capture different conformational states with and without inhibitors

Crosslinking Mass Spectrometry:

  • Identifies interaction interfaces between MT-ND4L and neighboring subunits

  • Provides distance constraints to validate structural models

  • Can capture dynamic interactions not visible in static structures

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Maps solvent-accessible regions and conformational dynamics

  • Particularly valuable for understanding membrane-embedded segments

  • Can track structural changes in response to mutations or inhibitors

Molecular Dynamics Simulations:

  • Complements experimental approaches by providing dynamic information

  • Can model lipid interactions and conformational flexibility

  • Useful for predicting effects of mutations on protein stability and function

When designing structural studies, researchers should consider preparing comparative analyses between pig MT-ND4L and other well-characterized species to highlight unique structural features that may impact function or drug binding .

How do mutations in MT-ND4L affect complex I assembly and function?

Mutations in MT-ND4L can have profound effects on mitochondrial function through several mechanisms:

Assembly Disruption:

  • Certain mutations prevent proper incorporation of MT-ND4L into complex I

  • This results in accumulation of assembly intermediates and decreased levels of fully assembled complex

  • Can be assessed through blue native PAGE and immunoblotting of mitochondrial fractions

Electron Transfer Efficiency:

  • Mutations in key residues can alter the electron transfer pathway

  • This typically manifests as decreased NADH:ubiquinone oxidoreductase activity

  • May lead to increased production of reactive oxygen species (ROS)

Proton Pumping Capacity:

  • Some mutations specifically affect proton translocation without altering electron transfer

  • This uncoupling leads to decreased ATP production despite normal NADH oxidation

  • Can be measured using fluorescent probes sensitive to membrane potential

Research has identified specific variants with clinical significance, such as the human MT-ND4L variant rs28709356 C>T (minor allele frequency = 0.002), which shows significant association with Alzheimer's disease risk (P = 7.3 × 10-5) . Similarly, the missense mutation MT:10609T > C in human MT-ND4L has been negatively correlated with obesity risk . These findings highlight the importance of systematic mutational analysis in understanding both normal function and disease mechanisms.

What is the evidence linking MT-ND4L mutations to neurodegenerative disorders?

Compelling evidence connects MT-ND4L variants to several neurodegenerative conditions:

Alzheimer's Disease:

  • Whole exome sequencing analysis of 10,831 participants from the Alzheimer's Disease Sequencing Project revealed a rare MT-ND4L variant (rs28709356 C>T) with significant association to AD risk (P = 7.3 × 10-5)

  • Gene-based analysis also showed significant association of MT-ND4L with AD (P = 6.71 × 10-5)

  • These findings support the mitochondrial cascade hypothesis of AD pathogenesis

Other Neurodegenerative Conditions:

  • MT-ND4L variations have been implicated in mitochondrial encephalomyopathy

  • Some variants show associations with increased susceptibility to Parkinson's disease

  • The protein's role in energy metabolism makes it relevant to multiple conditions involving neuronal energy deficits

The mechanistic link involves impaired energy production, increased oxidative stress, and compromised calcium homeostasis – all critical factors in neurodegeneration. These associations highlight the potential of MT-ND4L as both a biomarker and therapeutic target for neurodegenerative disorders .

How can recombinant pig MT-ND4L be utilized in drug discovery and development?

Recombinant pig MT-ND4L offers several valuable applications in therapeutic development:

Target-Based Screening:

  • Purified protein can be incorporated into high-throughput screening assays to identify compounds that modulate complex I activity

  • Fluorescence-based assays measuring NADH consumption or membrane potential can assess compound effects

  • Differential scanning fluorimetry can identify stabilizing molecules as potential drug candidates

Structure-Based Drug Design:

  • High-resolution structures obtained via cryo-EM can guide rational design of compounds targeting specific MT-ND4L regions

  • Molecular docking studies can identify potential binding pockets

  • Pig MT-ND4L offers a mammalian system closer to human than bacterial models

Disease-Specific Applications:

  • Recombinant systems expressing disease-associated mutations can evaluate compound efficacy in rescuing function

  • Compounds showing activity may represent candidates for neurodegenerative disease treatment

  • The porcine system provides a good balance between homology to human proteins and experimental tractability

Biomarker Development:

  • Antibodies raised against recombinant pig MT-ND4L can be used to develop assays detecting mitochondrial damage

  • These assays could serve as companion diagnostics for mitochondrial-targeted therapeutics

  • May help identify patients most likely to benefit from complex I-targeted interventions

What role does MT-ND4L play in metabolic disorders like obesity?

Research has revealed important connections between MT-ND4L and metabolic regulation:

Obesity Associations:

  • The missense mutation MT:10609T > C in human MT-ND4L was found to be negatively correlated with obesity risk, suggesting a protective effect

  • This aligns with other studies linking mitochondrial function to adipose tissue metabolism and insulin sensitivity

Metabolic Mechanisms:

  • MT-ND4L impacts cellular energy efficiency through its role in complex I

  • Variants may alter the balance between ATP production and heat generation

  • Changes in complex I efficiency affect reactive oxygen species production, which influences insulin signaling pathways

Research Applications:

  • Recombinant pig MT-ND4L can be used to study the effect of specific mutations on energy metabolism

  • Cell-based assays incorporating mutant versions can assess impacts on adipocyte differentiation and function

  • Animal models with targeted MT-ND4L modifications can evaluate whole-body metabolic effects

This connection between a core mitochondrial protein and metabolic disorders highlights the central role of bioenergetics in maintaining metabolic health, suggesting complex I modulators could have therapeutic potential in metabolic disorders .

How can researchers effectively design MT-ND4L constructs for structural studies?

Successful structural studies require careful construct design:

Optimization Strategies:

  • Create multiple constructs with varying N- and C-terminal boundaries to identify stable versions

  • Consider fusion partners that enhance solubility (e.g., MBP, SUMO) with precision-engineered protease sites

  • Include purification tags that minimally impact structure (e.g., small His-tags)

  • Design surface entropy reduction mutations to promote crystallization if applicable

Expression Vector Considerations:

  • Select vectors with tight expression control to prevent toxicity

  • Include fluorescent reporter tags in initial constructs to monitor expression and localization

  • Consider inducible promoters with gradient response capability for optimization

  • Engineer codon optimization for the expression system while maintaining critical folding kinetics

Sequence Modifications for Structural Studies:

  • Consider cysteine-free variants to prevent non-native disulfide formation

  • Introduce site-specific labels for spectroscopic studies at non-conserved positions

  • Design construct libraries with systematic truncations for high-throughput screening

  • Include specific residues for heavy atom derivatization if pursuing crystallographic methods

A systematic approach testing multiple constructs in parallel typically yields the most efficient path to successful structural determination.

What are the methodological challenges in developing specific antibodies against pig MT-ND4L?

Developing antibodies against MT-ND4L presents several unique challenges:

Antigen Design Considerations:

  • The high hydrophobicity of MT-ND4L makes traditional immunization approaches difficult

  • Strategic selection of antigenic regions should focus on predicted extramembrane loops

  • Consider synthesizing peptides corresponding to these regions rather than using whole protein

  • Carefully evaluate sequence conservation if cross-reactivity with other species is desired

Immunization Protocols:

  • Extended immunization schedules with multiple boosts typically required

  • Consider alternative carrier proteins to enhance immunogenicity of hydrophobic segments

  • DNA immunization approaches may generate better responses against conformational epitopes

  • Combine multiple adjuvants to enhance immune response against this challenging target

Antibody Validation Requirements:

  • Rigorous validation using multiple approaches:

    • Western blotting of mitochondrial fractions

    • Immunoprecipitation followed by mass spectrometry

    • Immunocytochemistry with appropriate subcellular markers

    • Testing against MT-ND4L knockout controls if available

    • Comparative testing against recombinant protein

Applications and Limitations:

  • Anti-MT-ND4L antibodies have valuable applications in:

    • Detection of complex I assembly defects

    • Immunoprecipitation for interaction studies

    • Tracking MT-ND4L in disease models

  • Researchers should be aware of potential limitations in detecting native protein in intact mitochondrial membranes

How can comparative studies across species inform our understanding of MT-ND4L evolution and function?

Cross-species analysis provides valuable evolutionary and functional insights:

Evolutionary Conservation Patterns:

  • Highly conserved residues across diverse species likely represent functionally critical positions

  • Species-specific variations may reflect adaptation to metabolic demands or environmental conditions

  • Molecular clock analysis can reveal evolutionary pressure specific to MT-ND4L versus other complex I subunits

Structure-Function Relationships:

  • Comparing MT-ND4L from species with different metabolic rates (e.g., pig vs. mouse) can highlight residues involved in regulating electron transfer efficiency

  • Species differences in proton pumping efficiency may correlate with specific amino acid substitutions

  • Thermophilic organisms can reveal adaptations that enhance protein stability

Disease-Relevant Insights:

  • Naturally occurring variants in non-human species that correspond to human disease mutations provide evolutionary context

  • Species lacking specific disease phenotypes despite carrying equivalent mutations may reveal compensatory mechanisms

  • Comparing the human rs28709356 C>T variant associated with Alzheimer's disease to corresponding positions in pig and other species may reveal tolerance mechanisms

A comprehensive evolutionary analysis incorporating sequence, structure, and functional data across species can significantly enhance our understanding of both basic biology and disease mechanisms related to MT-ND4L.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.