Recombinant Pig Neuropeptide Y receptor type 1 (NPY1R)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Host SystemPurityApplicationsSource
E. coli≥85%SDS-PAGE, WB, Immunogen
Mammalian Cells≥85%Functional assays, Structural studies
  • Tagging: His-tagged variants enable affinity chromatography .

  • Yield: Lyophilized powder formulations ensure stability for long-term storage .

Key Research Findings

  • Dynamic Behavior: Solid-state NMR and MD simulations reveal conformational changes in apo, agonist-, and arrestin-bound states, critical for ligand binding and signaling .

  • Pain Modulation: Y1R knockout mice exhibit heightened sensitivity to thermal/chemical pain, implicating NPY1R in nociceptive pathways .

  • Immune Regulation: NPY-Y1R signaling inhibits dendritic cell maturation and promotes Th2 polarization via IL-6/IL-10 .

Pharmacological Profile

LigandAffinity (pM)Species TestedSource
Porcine NPY43Guinea pig, Human
PYY48Guinea pig
NPY2-366-fold lowerGuinea pig

Applications in Research

  • Drug Discovery: Used to screen Y1R antagonists (e.g., BIBP3226) for obesity and pain therapies .

  • Structural Biology: NMR studies resolve dynamics in lipid membranes, aiding GPCR-targeted drug design .

  • Immunology: Elucidates NPY’s role in leukocyte adhesion and granulocyte phagocytosis .

Comparative Evolutionary Insights

  • Gene Clustering: Pig NPY1R, NPY2R, and NPY5R cluster on chromosome 8, homologous to human chromosome 4, suggesting conserved evolutionary duplication events .

  • Sequence Identity: 92–94% similarity between pig, human, and mouse Y1 receptors .

Key Challenges and Future Directions

  • Heterogeneity: Subpopulations of Y1R-expressing spinal neurons (e.g., Grp/Npy1r, Npff/Npy1r) complicate pain pathway targeting .

  • Species-Specificity: Guinea pig Y1R pharmacology overlaps with humans but shows unique ligand sensitivity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All protein orders are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own formulations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
NPY1R; Neuropeptide Y receptor type 1; NPY1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MNSTLSSQVENHSIYYNFSEKNSQFLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEVMCKLNPFVQ CVSITVSIFSLVLIAVERHQLIINPRGWRPSNRHAYVGIAVIWVLAVASSLPFLIYQVLT DEPFQNVTLDAFKDKYVCFDKFLSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR RNNMMDKMRDNKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL LFLLCHLTAMISTCINPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYEVIAMSTMHTDVS KTSLKQASPVALKKIHSDDNEKI
Uniprot No.

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.