Recombinant Pig Neuropeptide Y receptor type 2 (NPY2R)

Shipped with Ice Packs
In Stock

Description

Ligand Binding and Selectivity

NPY2R exhibits preferential binding for C-terminal fragments of NPY and PYY:

LigandAffinity (nM)SelectivitySource
NPY1–360.5–1.0LowHuman, Pig
NPY3–360.3–0.7High (Y2R)Pig, Rat
PYY1–360.2–0.5High (Y2R)Human, Pig
PYY3–360.1–0.4High (Y2R)Pig, Mouse
Pancreatic Polypeptide>1000LowHuman, Pig

Data synthesized from .

The receptor’s selectivity for truncated peptides (e.g., NPY3–36) arises from its tolerance of N-terminal proteolysis by dipeptidyl peptidase 4 .

Neuroprotection and Stroke

  • Y2R activation reduces cerebral infarction volume by 40–60% in hypertensive rats post-ischemia .

  • Mechanisms include inhibition of glutamate release and protection of the neurovascular unit (NVU) .

Metabolic Regulation

  • NPY2R knockout mice exhibit hyperphagia (+30% food intake) and obesity .

  • In medaka fish, npy2r deletion increases food intake and growth rates, suggesting evolutionary conservation of feeding regulation .

Renal and Cardiovascular Effects

  • NPY-NPY2R signaling in podocytes promotes albuminuria via PI3K/ERK and calcineurin-NFAT pathways .

  • Antagonism with BIIE0246 reduces albuminuria by 50% in murine models .

Agonists vs. Antagonists

CompoundEffectApplication
NPY13–36 (agonist)Neuroprotection, reduced infarctionIschemic stroke
BIIE0246 (antagonist)Attenuates albuminuriaChronic kidney disease
PYY3–36 (agonist)Suppresses appetiteObesity/metabolic syndrome

Data from .

Clinical Relevance

  • Epilepsy: Upregulation of Y2R in hippocampal sclerosis correlates with reduced seizure severity .

  • Angiogenesis: The receptor’s extracellular domain supports endothelial cell proliferation, implicating it in retinopathy and tumor growth .

Table: Experimental Models and Outcomes

Study ModelInterventionKey OutcomeReference
Hypertensive ratsY2R agonist (NPY3–36)↓ Infarction volume, ↑ motor recovery
NPY2R knockout miceHigh-fat diet↑ Weight gain, ↑ adiposity
Podocyte cell cultureNPY + BIIE0246↓ ERK/Akt phosphorylation
Retinal cell cultureNPY Y2R immunolabelingExpressed in neurons and glia

Challenges and Future Directions

  • Structural Insights: Cryo-EM studies are needed to resolve the receptor’s active-state conformation .

  • Species-Specific Effects: Functional differences between pig and human NPY2R (e.g., ligand kinetics) require further characterization .

  • Drug Development: Dual-target agonists for Y2R/Y4R may enhance metabolic efficacy while minimizing off-target effects .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing your order. We will then prepare your product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for specific delivery time information.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MGPIGAEADENQTVEEMKMEPSGPGHTTPRGELAPDSEPELKDSTKLIEVQIILILAYCS IILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMG PVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALL ASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSY ARIWSKLKNHVSPGGVNDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLD LKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTSKA KKNLEATKNGGPDDSFTEATNV
Uniprot No.

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NPY2R and what are its primary functions in pigs?

Neuropeptide Y receptor type 2 (NPY2R) is a G protein-coupled receptor that belongs to the Y2 subfamily of NPY receptors. In pigs, as in other mammals, NPY2R functions primarily as a presynaptic receptor involved in:

  • Regulation of feeding behavior and energy homeostasis

  • Modulation of anxiety and stress-related behavior

  • Control of pain perception pathways

Amino acid sequence alignment shows that pig NPY2R shares 55.7% homology with human NPY2R and 49.2% homology with mouse NPY2R, suggesting evolutionary conservation of core functional domains despite species-specific adaptations .

How is the structure of pig NPY2R different from other species?

Pig NPY2R shows distinct structural characteristics compared to other species:

  • The coding region contains an intron, which is a feature unique to the NPY1R subfamily in most species, but also present in NPY2R

  • Synteny analysis reveals that NPY2R adjacent genes are highly conserved among various vertebrate species, but pig NPY2R shows different synteny patterns compared to human and mouse

  • The pig NPY2R intron shows relatively high conservation (71-74% identity) when compared to human and guinea pig introns, suggesting functional constraints on this non-coding region

What techniques are commonly used to express recombinant pig NPY2R?

For successful expression of recombinant pig NPY2R, several methodological approaches have proven effective:

  • Mammalian expression systems: HEK293 or CHO cell lines transfected with pig NPY2R cDNA using lipofection or electroporation

  • Baculovirus-insect cell systems: Sf9 or High Five cells for higher protein yield

  • Yeast expression systems: Pichia pastoris for large-scale production

Table 1: Comparison of Expression Systems for Recombinant Pig NPY2R

Expression SystemAdvantagesDisadvantagesTypical Yield (mg/L)Post-translational Modifications
HEK293 cellsNative-like folding, proper glycosylationLower yields, higher cost0.5-2Most similar to native
CHO cellsScalable, stable cell lines possibleTime-consuming selection1-5Extensive glycosylation
Sf9/High Five cellsHigher yields, cost-effectiveDifferent glycosylation pattern5-20Limited glycosylation
Pichia pastorisVery high yields, inexpensiveMay require refolding10-50Minimal glycosylation

How should I design binding assays for recombinant pig NPY2R?

When designing binding assays for recombinant pig NPY2R, consider the following methodological approach:

  • Radioligand binding assays:

    • Use [125I]-labeled PYY3-36 or NPY as ligands (high affinity for NPY2R)

    • Perform saturation binding experiments to determine Kd and Bmax values

    • Include displacement studies with selective Y2R ligands like BIIE0246 to confirm specificity

  • Fluorescence-based assays:

    • FRET or BRET-based assays using fluorescently labeled ligands

    • Time-resolved fluorescence for improved signal-to-noise ratio

  • Controls and validation:

    • Use human NPY2R for cross-species comparison

    • Include non-transfected cells as negative controls

    • Validate with functional assays (calcium mobilization, cAMP inhibition)

When analyzing binding data, use non-linear regression to fit competition binding curves and calculate IC50 values. Converting to Ki values using the Cheng-Prusoff equation will account for differences in radioligand concentrations across experiments .

What are the best methods for studying NPY2R signaling pathways in pig models?

To effectively study NPY2R signaling pathways in pig models:

  • In vitro approaches:

    • MAPK/ERK pathway analysis: Monitor phosphorylation of ERK1/2 following NPY stimulation using Western blot or ELISA-based phospho-specific detection

    • Calcium signaling: Use fluorescent calcium indicators (Fura-2, Fluo-4) to measure intracellular calcium mobilization

    • cAMP assays: Measure the inhibition of forskolin-stimulated cAMP production using ELISA or HTRF-based assays

  • Ex vivo tissue analysis:

    • Receptor autoradiography: Use [125I]-PYY3-36 to map NPY2R distribution in pig brain and peripheral tissues

    • Electrophysiology: Record neuronal responses to NPY and selective NPY2R agonists in brain slices

  • In vivo approaches:

    • PET imaging: Utilize N-11C-methyl-JNJ-31020028 as a radiotracer for NPY2R visualization in live pigs

    • Pharmacological intervention: Administer the NPY2R antagonist BIIE0246 to evaluate pathway involvement in physiological responses

When analyzing signaling pathways, it's critical to establish temporal dynamics, as NPY2R activation has been shown to produce both rapid (seconds to minutes) and delayed (hours) signaling events .

How can I optimize CRISPR/Cas9-mediated gene editing for studying pig NPY2R function?

For optimal CRISPR/Cas9-mediated editing of pig NPY2R:

  • Guide RNA design:

    • Target conserved regions within exon 2, which contains most of the coding sequence

    • Design multiple gRNAs (at least 3-4) targeting different regions

    • Use algorithms that predict off-target effects and select guides with high specificity scores

  • Delivery methods:

    • For pig embryos: microinjection of Cas9 protein with pre-complexed gRNAs

    • For cell lines: lipofection or electroporation followed by selection

    • For somatic gene editing: AAV or lentiviral vectors for tissue-specific delivery

  • Validation strategies:

    • Implement T7 endonuclease I assay for initial screening

    • Use next-generation sequencing to characterize edited loci

    • Perform Western blot and functional assays to confirm protein knockout

  • Common challenges and solutions:

    • Mosaicism in founder animals: screen multiple tissues and perform thorough breeding

    • Off-target effects: use high-fidelity Cas9 variants (SpCas9-HF1 or eSpCas9)

    • Homology-directed repair efficiency: include repair templates with extended homology arms (>800 bp)

What are the critical considerations when interpreting contradictory data on NPY2R function across species?

When faced with contradictory data on NPY2R function across species, consider these analytical approaches:

  • Evolutionary context analysis:

    • Phylogenetic analysis reveals that pig NPY2R is evolutionarily closer to human NPY2R than rodent models

    • Synteny analysis shows that NPY2R genomic context differs between pigs and mice/humans, potentially affecting regulation

  • Methodological differences:

    • Different antagonists may have species-specific affinities

    • Knockout strategies (global vs. conditional, developmental timing) can produce different phenotypes

    • Behavioral tests developed for rodents may not translate directly to pigs

  • Physiological context:

    • NPY2R in rodents is implicated in anxiety and feeding behavior, but knockout phenotypes vary across species

    • In pigs, NPY2R may have specialized functions related to their different metabolic and feeding patterns

  • Reconciliation strategies:

    • Perform parallel experiments using identical protocols across species

    • Consider compensatory mechanisms that may be species-specific

    • Use domain swapping or point mutations to identify species-specific functional elements

How can I develop tissue-specific NPY2R expression systems to study region-specific functions in the pig brain?

To develop tissue-specific NPY2R expression systems for pig brain studies:

  • Vector design considerations:

    • Use cell-type specific promoters (e.g., GFAP for astrocytes, synapsin for neurons)

    • Include Cre-loxP or Tet-On/Off systems for temporal control

    • Consider viral vector capacity limitations when designing constructs

  • Delivery approaches:

    • Stereotaxic injection of viral vectors (AAV9 crosses BBB effectively)

    • For broader distribution, intracerebroventricular delivery

    • For developing animals, in utero electroporation

  • Validation methods:

    • Immunohistochemistry with co-localization markers for target cell types

    • In situ hybridization to confirm transcript expression

    • Functional validation using calcium imaging or electrophysiology

  • Brain region targeting strategy:

    • Based on PET imaging data, prioritize regions with high endogenous NPY2R expression (hippocampus, amygdala, hypothalamus)

    • Use stereotaxic coordinates validated for pig brain anatomy

    • Consider combination with optogenetic or chemogenetic tools for functional validation

What behavioral paradigms are most appropriate for assessing NPY2R function in pigs?

For assessing NPY2R function in pigs, these behavioral paradigms are most appropriate:

  • Anxiety-related behaviors:

    • Open field test (adapted for pig size)

    • Novel object recognition

    • Elevated plus maze (modified for pigs)

    • Social interaction tests

  • Feeding behavior assessment:

    • Meal pattern analysis using automated feeding stations

    • Food preference tests

    • Operant conditioning paradigms for food reward

    • Stress-induced feeding changes

  • Pain sensitivity tests:

    • Von Frey filament testing (for mechanical sensitivity)

    • Thermal sensitivity tests (adapted for pigs)

    • Conditioned place preference/aversion for pain states

  • Cognitive assessment:

    • T-maze and Y-maze for spatial learning

    • Discrimination learning tasks

    • Recognition memory tests

When implementing these tests, consider the following methodological aspects:

  • Allow sufficient habituation time (pigs require longer habituation periods than rodents)

  • Use appropriate control groups (littermates, wild-type)

  • Account for diurnal variations in behavior

  • Validate testing parameters specifically for pigs, as protocols developed for rodents may not directly translate

How do I reconcile contradictory findings between in vitro NPY2R signaling and in vivo phenotypes?

To reconcile contradictory findings between in vitro NPY2R signaling and in vivo phenotypes:

  • Systems biology approach:

    • Map the complete signaling network in both systems

    • Identify compensatory pathways active in vivo but absent in vitro

    • Quantify differences in receptor expression levels between systems

  • Temporal dynamics analysis:

    • In vitro systems often capture acute effects (minutes to hours)

    • In vivo phenotypes may reflect chronic adaptations (days to weeks)

    • Implement time-course studies in both systems to identify divergence points

  • Methodological considerations:

    • Evaluate pharmacokinetic properties of compounds used (tissue distribution, half-life)

    • Consider off-target effects present in vivo but not detected in vitro

    • Assess influence of anesthesia in in vivo studies

  • Integration strategy:

    • Develop intermediate models (ex vivo tissue slices, organoids)

    • Use mathematical modeling to predict how in vitro mechanisms scale to in vivo systems

    • Implement parallel readouts across systems (e.g., same phosphorylation targets)

What molecular imaging techniques can be applied to study pig NPY2R distribution and function?

For studying pig NPY2R distribution and function, these molecular imaging techniques are most valuable:

  • PET imaging approaches:

    • Use N-11C-methyl-JNJ-31020028 as a specific NPY2R radiotracer

    • Implement dynamic scanning protocols (60-90 minutes)

    • Analyze data using simplified reference tissue models with corpus callosum as reference region

  • SPECT imaging alternatives:

    • Develop 123I-labeled NPY analogs with Y2 selectivity

    • Longer half-life allows for longitudinal studies

  • Optical imaging for ex vivo analysis:

    • Near-infrared fluorescent labeled peptides for receptor mapping

    • Multiphoton microscopy for deep tissue imaging

  • Multimodal approaches:

    • Combined PET-MRI for anatomical correlation

    • PET-CT for attenuation correction and anatomical reference

Table 2: Comparison of Molecular Imaging Approaches for Pig NPY2R

TechniqueSpatial ResolutionTemporal ResolutionDepth PenetrationKey AdvantagesLimitations
PET with N-11C-methyl-JNJ-310200282-3 mm1-2 minUnlimitedSpecific binding quantificationRequires cyclotron, short half-life (20 min)
SPECT with 123I-NPY analogs8-10 mm5-10 minUnlimitedLonger isotope half-life (13h)Lower sensitivity than PET
Near-infrared optical imaging1-2 mmSeconds1-2 cmReal-time imagingLimited to superficial tissues
Multiphoton microscopy<1 μmMilliseconds0.5-1 mmCellular resolutionVery limited depth
PET-MRI2-3 mm1-2 minUnlimitedCombined functional/anatomicalHigh cost, complex data analysis

When implementing these techniques, cyclosporine A pretreatment can enhance brain penetration of radiotracers, improving target-to-background ratios as demonstrated in pig studies .

How can pig NPY2R research be translated to human therapeutic applications?

To effectively translate pig NPY2R research to human therapeutic applications:

  • Comparative pharmacology approach:

    • Characterize binding profiles of potential therapeutic compounds on both pig and human NPY2R

    • Identify species-specific differences in receptor activation and signaling

    • Use this data to predict human responses from pig models

  • Disease model validation:

    • Establish pig models for conditions where NPY2R is implicated:

      • Obesity and metabolic disorders

      • Anxiety and stress-related conditions

      • Chronic pain models (especially neuropathic pain)

      • Kidney disease models

  • Biomarker development:

    • Identify conserved downstream signatures of NPY2R activation

    • Develop non-invasive monitoring approaches (e.g., salivary NPY2R expression)

    • Validate cross-species conservation of these biomarkers

  • Therapeutic development strategy:

    • For antagonist development: Focus on conditions where excessive NPY-NPY2R signaling is pathogenic (e.g., albuminuric kidney disease)

    • For agonist development: Target conditions benefiting from NPY2R activation (e.g., anxiety, stress resilience)

    • Consider combination approaches with other neuropeptide systems

What are the methodological considerations for studying NPY2R in pig disease models relevant to human health?

When studying NPY2R in pig disease models with human health relevance:

  • Model selection and validation:

    • Metabolic disorders: Mini-pigs fed high-fat diets develop obesity phenotypes more similar to humans than rodent models

    • Neuropsychiatric conditions: Validate behavioral readouts specifically for pigs

    • Pain models: Consider spontaneous versus evoked pain behaviors

    • Kidney disease: Adriamycin-induced kidney damage has been validated for NPY2R studies

  • Experimental design considerations:

    • Account for pig growth and development when planning long-term studies

    • Include appropriate controls for sex differences in NPY2R function

    • Implement power calculations based on pig variability (typically higher than inbred mice)

  • Pharmacological intervention strategies:

    • Adjust dosing based on pig-specific pharmacokinetics

    • Consider formulation challenges for large animal administration

    • Implement drug delivery approaches suitable for chronic administration

  • Outcome measures:

    • Use clinically relevant endpoints (e.g., albuminuria for kidney disease)

    • Implement non-invasive monitoring where possible

    • Consider quality of life measures alongside physiological parameters

How do differences in NPY2R signaling between pigs and humans impact drug development strategies?

Differences in NPY2R signaling between pigs and humans significantly impact drug development in the following ways:

Table 3: Comparison of NPY2R Properties Relevant to Drug Development

PropertyPig NPY2RHuman NPY2RImpact on Drug Development
Amino acid homologyReference55.7% identity to pigPotential differences in binding pocket structure
Genomic organizationContains intron in coding regionContains intron in coding regionSimilar transcript processing
Tissue distributionHigh in hippocampus, amygdalaHigh in hippocampus, amygdalaConserved central nervous system targets
Antagonist affinity (BIIE0246)Strong bindingStrong bindingSimilar pharmacology for this compound
Signaling pathwaysMAPK, PI3K, NFATMAPK, PI3K, NFATConserved primary signaling mechanisms
PharmacokineticsSpecies-specificSpecies-specificRequires separate PK/PD modeling
Blood-brain barrier penetrationModerateModerateSimilar CNS drug delivery challenges

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.