Recombinant Pig Neuropeptide Y receptor type 5 (NPY5R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it according to your request.
Synonyms
NPY5R; NPYR5; Neuropeptide Y receptor type 5; NPY5-R; NPY-Y5 receptor; NPYY5-R; Y5 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MGSEIPDYYNKTLASENNTVATRNSGFPVWEDYKGSVDDLQYFLIGLYTFVSLLGFMGNL LILMAVMRKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL QCVTVLVSTLILISIAIVRYHMIKHPVSNNLTANHGYFLIATVWTLGLAICSPLPVFHSL VELQESFGSAWLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRTISC GLSSQDSKLEENEMINLTLQPAKRSGPQAKLSHHPKWTYSFIRRHRRRYSKKTACVRPAP AGPALESREGRPPGKVGSMQSQPPPSNKFMPGVPTCFEVKPEENSDVPEMRVSRSIMRLR KRSRSVFYRLTVLILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL NPILYGFLNNGIKADLMSLIHCLHVS
Uniprot No.

Target Background

Function
This receptor acts as a receptor for neuropeptide Y and peptide YY. Its activity is mediated by G proteins, which inhibit adenylate cyclase activity. It is believed to be associated with food intake and may play a role in feeding disorders.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Neuropeptide Y Receptor Type 5 (NPY5R) and what is its significance in pigs?

NPY5R is a G-protein coupled receptor that serves as a receptor for neuropeptide Y (NPY) and peptide YY (PYY). The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity . In pigs, as in other mammals, NPY5R plays a crucial role in regulating food intake and energy homeostasis. Research indicates that NPY5R is particularly significant in feeding regulation, making it an important target for studies on appetite control and metabolic disorders . As pigs serve as important agricultural animals and biomedical research models, understanding NPY5R function provides insights into both livestock production efficiency and human metabolic disease mechanisms.

How does pig NPY5R compare structurally to human and other mammalian NPY5R?

Pig NPY5R would be expected to maintain the characteristic seven-transmembrane domain structure of GPCRs, with the ligand binding pocket formed by the transmembrane helices and extracellular loops. The extracellular loops of NPY receptors, particularly ECL2, contribute significantly to the binding interface for peptide agonists, with ECL2 forming a hairpin structure that creates a hydrophobic binding pocket .

What are the primary ligands for pig NPY5R and their binding affinities?

The primary endogenous ligands for NPY5R are neuropeptide Y (NPY) and peptide YY (PYY) . NPY has high affinity for Y1, Y2, and Y5 receptors . Specific to Y5 receptors, studies have developed chimeric peptides with exceptionally high binding affinity. For example, a ligand containing segments 1-7 from chicken PP (cPP) and 19-23 from pig NPY (pNPY) within the human PP sequence demonstrated an IC₅₀ of 40 pM at the Y5 receptor, making it the most potent Y5-receptor ligand known, with 15-fold higher affinity than NPY itself .

Unlike Y1R and Y4R, which require the full-length N terminus of NPY for full agonist activity, Y5R accepts peptides with deletion of the first residue while maintaining high affinity binding . For antagonists, CGP 71683A has been identified as having high affinity for the Y5 receptor (K₁ value of 1.3±0.05 nM) without significant activity at Y1 and Y2 receptors .

What expression systems are optimal for producing recombinant pig NPY5R?

Based on the available research, multiple expression systems can be considered for recombinant pig NPY5R production, with selection depending on the experimental purpose:

  • Wheat germ cell-free expression systems have been successfully used for human NPY5R production and would likely be effective for pig NPY5R .

  • For structural studies requiring large quantities of purified receptor, insect cell expression systems (Sf9 or High Five cells) or mammalian expression systems (HEK293 or CHO cells) are recommended.

  • For functional studies, mammalian cell lines provide a more native-like environment with appropriate post-translational modifications and G-protein coupling machinery.

When expressing recombinant pig NPY5R, consider adding tags to facilitate purification and detection. Research on other NPY receptors has successfully used modifications such as a hemagglutinin (HA) signal peptide and a Flag epitope tag at the N-termini, with a twin-strep-tag replacing C-terminal residues . These modifications have been shown to have minimal effect on receptor signaling in other NPY receptors.

What are the recommended protocols for functional characterization of recombinant pig NPY5R?

Functional characterization of recombinant pig NPY5R should incorporate multiple complementary approaches:

  • Ligand binding assays: Competitive binding assays using radiolabeled or fluorescently labeled NPY or selective Y5R ligands to determine binding affinities. This approach has been used to characterize the pharmacological profiles of NPY receptors across species .

  • G-protein coupling assays: Since NPY5R inhibits adenylate cyclase activity through G proteins , measurement of cAMP levels following receptor activation provides a functional readout.

  • Receptor internalization studies: Using fluorescently tagged receptors to monitor endocytosis following agonist stimulation.

  • In vivo functional characterization: Behavioral studies measuring food intake following intracerebroventricular infusion of NPY or selective Y5R agonists, with or without Y5R antagonist pretreatment, have been effectively used in other species and could be adapted for pigs .

When designing these studies, it's essential to include appropriate controls, such as Y5R-selective antagonists (e.g., CGP 71683A) and comparison with other NPY receptor subtypes to confirm specificity of effects .

How can binding affinities of different ligands to pig NPY5R be accurately measured?

Accurate measurement of binding affinities for different ligands to pig NPY5R involves several established methodologies:

  • Competitive binding assays: Using a fixed concentration of a labeled reference ligand and varying concentrations of the test ligand. The IC₅₀ values can then be converted to K₁ values using the Cheng-Prusoff equation. This approach has been used extensively for characterizing NPY receptor pharmacology .

  • Saturation binding experiments: These determine the maximal binding capacity (Bₘₐₓ) and equilibrium dissociation constant (Kd) by measuring specific binding at increasing concentrations of labeled ligand.

  • Functional affinity measurements: Since NPY5R couples to G₁/ₒ proteins that inhibit adenylate cyclase , measuring the reduction in forskolin-stimulated cAMP levels can provide EC₅₀ values for agonists.

When designing these experiments, it's crucial to include appropriate positive controls such as NPY and the highly potent chimeric peptides described in the literature , as well as selective antagonists like CGP 71683A . This allows for proper validation of the binding assay and enables accurate comparison of novel ligands to established reference compounds.

How do specific amino acid residues in pig NPY5R contribute to ligand binding specificity?

The molecular basis of ligand binding specificity in NPY5R involves complex interactions between the receptor and its peptide ligands:

The N terminus and extracellular loops of NPY receptors comprise 40-61% of the binding interface for peptide agonists . Among these, ECL2 contributes most significantly to peptide binding, with its hairpin structure forming a hydrophobic binding pocket .

Despite interacting with the same family of peptide ligands, NPY receptors have poor sequence identity (27-32%) , indicating that specific residues must be responsible for their distinct ligand binding properties. For Y5R specifically, it accepts peptides with deletion of the first residue while maintaining high affinity , suggesting that certain residues in the binding pocket accommodate this structural difference compared to other receptor subtypes.

Studies with chimeric NPY/PP peptides have demonstrated that exchanging specific segments between peptides dramatically alters receptor subtype selectivity . A ligand containing segments 1-7 from chicken PP and 19-23 from pig NPY within the human PP sequence showed exceptional affinity for Y5R , indicating complementary interactions between these peptide segments and specific residues in the Y5R binding pocket.

While specific binding residues in pig NPY5R have not been directly identified in the available research, these studies provide a framework for understanding the structural basis of ligand recognition and selectivity.

What are the key differences in signaling pathways between pig NPY5R and other NPY receptor subtypes?

Several key differences in signaling pathways can be inferred between NPY5R and other NPY receptor subtypes:

  • G-protein coupling: NPY5R activity is mediated by G proteins that inhibit adenylate cyclase activity . While this G₁/ₒ coupling is shared with other NPY receptor subtypes, the efficiency and specificity of coupling may differ.

  • Downstream effects on feeding behavior: Y1 and Y5 receptors both mediate NPY-induced food intake in mammals, suggesting parallel but potentially distinct signaling pathways . When Y5R antagonists (like CGP 71683A) or Y1R antagonists (BIBO 3304 and H 409/22) are administered separately, each attenuates NPY-induced feeding responses . This indicates that Y1R and Y5R signaling pathways likely work in parallel or synergistically rather than redundantly.

  • Ligand-specific signaling: Different ligands may induce distinct conformational changes in the receptor, potentially leading to biased signaling through different downstream pathways. The availability of highly selective ligands, such as the chimeric peptides with exceptional Y5R affinity , provides tools to investigate these potential signaling differences.

Understanding these signaling differences is crucial for developing targeted therapeutic approaches that modulate specific pathways downstream of NPY5R activation.

How can recombinant pig NPY5R be used in structure-based drug design studies?

Recombinant pig NPY5R offers several valuable applications for structure-based drug design:

  • Structural determination: High-yield expression and purification of recombinant pig NPY5R could enable structural studies using X-ray crystallography or cryo-electron microscopy. These structures would provide "molecular details that define the recognition of NPY by different NPY receptors and enable structure-based drug design" .

  • Ligand binding site mapping: Site-directed mutagenesis combined with binding assays can identify critical residues involved in ligand recognition, revealing receptor-specific binding pockets that can be targeted for selective drug design.

  • Structure-activity relationship (SAR) studies: Systematically modifying NPY peptides or small molecule ligands and assessing their effects on binding and function can identify critical chemical features for receptor interaction. The studies with chimeric peptides demonstrate this approach's potential, having developed a ligand with IC₅₀ of 40 pM at the Y5-receptor (15-fold higher affinity than NPY) .

  • Comparative pharmacology: Since pigs are physiologically similar to humans, studying pig NPY5R could provide insights specifically relevant to human drug development while potentially revealing species-specific differences that might affect drug efficacy or safety.

These approaches can lead to the development of novel therapeutic agents targeting NPY5R for treatment of feeding disorders and obesity, with improved selectivity and reduced off-target effects.

What are common challenges in expressing functional recombinant pig NPY5R and how can they be addressed?

Researchers working with recombinant pig NPY5R may encounter several challenges typical of GPCR expression studies:

  • Low expression levels: GPCRs often express poorly in heterologous systems. This can be addressed by:

    • Optimizing codon usage for the expression system

    • Using stronger promoters or inducible expression systems

    • Adding signal sequences to improve membrane targeting

    • Including tags that enhance folding and stability (e.g., N-terminal modifications as mentioned in the research)

  • Improper folding and aggregation: As membrane proteins, GPCRs may not fold correctly in some expression systems, leading to non-functional protein. Solutions include:

    • Using mammalian or insect cell expression systems that provide a more native-like membrane environment

    • Expression at lower temperatures to slow protein synthesis and allow proper folding

    • Addition of chemical chaperones to the culture medium

  • Receptor instability: NPY receptors may be unstable once extracted from the membrane. Strategies to improve stability include:

    • Addition of stabilizing mutations identified through alanine scanning

    • Use of lipid nanodisc technology to maintain a native-like membrane environment

    • Expression as fusion proteins with stability-enhancing partners

  • Functional validation: Confirming that the expressed receptor is functional through binding assays or signaling assays is essential. Positive controls using well-characterized NPY5R ligands such as NPY or the highly potent chimeric peptides should be included.

How can researchers reconcile conflicting binding data between different experimental approaches?

When facing conflicting binding data for pig NPY5R across different experimental approaches, researchers should systematically evaluate several factors:

  • Assay format differences:

    • Competitive vs. saturation binding assays may yield different affinity values

    • Functional assays (measuring signaling responses) vs. direct binding assays may reflect differences in receptor states or coupling efficiency

  • Experimental conditions:

    • Buffer composition (pH, ionic strength, presence of divalent cations)

    • Temperature and incubation time

    • Protein concentration and ligand depletion effects

  • Receptor sources:

    • Different expression systems may produce receptors with varying post-translational modifications

    • Native tissue preparations vs. recombinant systems

  • Data analysis approaches:

    • Different mathematical models for fitting binding curves

    • One-site vs. two-site binding models

    • Consideration of non-specific binding

  • Cross-validation strategies:

    • Use multiple, orthogonal assay formats

    • Validate with well-characterized reference compounds like CGP 71683A (K₁ value of 1.3±0.05 nM)

    • Compare results with published data on related species

Through systematic evaluation of these factors, researchers can identify the source of discrepancies and develop a more accurate understanding of pig NPY5R pharmacology.

What controls should be included when studying recombinant pig NPY5R to ensure data validity?

Robust experimental design for recombinant pig NPY5R studies should include multiple controls:

  • Pharmacological controls:

    • Positive controls: Known high-affinity ligands for Y5R, such as NPY or the chimeric peptide with IC₅₀ of 40 pM

    • Negative controls: Compounds known not to bind Y5R, or truncated NPY peptides with poor Y5R affinity

    • Selectivity controls: Y1R-selective compounds (BIBO 3304, H 409/22) and other subtype-selective ligands to confirm receptor identity

  • Expression controls:

    • Western blotting or flow cytometry to confirm receptor expression levels

    • Surface expression assays to verify proper membrane localization

    • Positive control constructs to validate the expression system

  • Functional assay controls:

    • System calibration with reference compounds of known potency

    • Vehicle controls to account for solvent effects

    • Forskolin controls for cAMP assays to verify system responsiveness

    • Concentration-response curves to determine assay dynamic range

  • Specificity controls:

    • Competitive binding with labeled and unlabeled ligand to demonstrate specificity

    • Non-transfected cells to control for endogenous receptor expression

    • Receptor-negative controls (point mutations that abolish binding)

Additionally, when designing functional studies involving feeding behavior, administration of Y5R antagonists like CGP 71683A serves as an important control to verify receptor involvement.

How relevant is pig NPY5R as a model for human NPY5R-related disorders?

The relevance of pig NPY5R as a model for human NPY5R-related disorders can be evaluated based on several factors:

  • Evolutionary conservation: While specific data on pig-human NPY5R similarity is not provided in the search results, we can infer from related evidence. The guinea-pig Y5 receptor has the highest amino acid identity to the human Y5 receptor reported for any non-primate NPY receptor orthologue . Given that pigs are often good models for human physiology, pig NPY5R likely shows significant homology to human NPY5R.

  • Physiological similarities: Pigs share many metabolic and physiological characteristics with humans, including omnivorous diet, similar gastrointestinal physiology, and comparable adipose tissue distribution. These similarities make pigs potentially valuable models for studying NPY5R's role in appetite regulation and obesity .

  • Pharmacological conservation: The search results indicate that NPY receptor pharmacology is partly conserved across species, with Y1 and Y5 receptors mediating NPY-induced food intake in multiple mammals . This suggests that pharmacological interventions targeting pig NPY5R may translate effectively to humans.

  • Disease modeling potential: NPY5R's involvement in feeding disorders makes this receptor particularly relevant for translational obesity research using pig models, which can develop obesity and metabolic disorders similar to humans.

These factors collectively suggest that pig NPY5R represents a valuable translational model for human NPY5R-related disorders, particularly those involving energy homeostasis and feeding behavior.

What differences in NPY5R function have been observed across species that might impact translational studies?

Several differences in NPY5R function across species may impact translational studies:

  • Pharmacological profiles: Different species may show variations in receptor pharmacology. For instance, the guinea-pig Y5 receptor displays a virtually identical pharmacological profile to the human Y5, in contrast to rat Y5 . This suggests that farm animals like pigs might be better translational models than rodents for some aspects of NPY5R pharmacology.

  • Receptor distribution: The tissue distribution and expression levels of NPY5R may vary between species, affecting the physiological responses to receptor activation. This could impact the translation of findings from animal models to humans.

  • Signaling pathway variations: While the primary G-protein coupling (to G₁/ₒ) of NPY5R appears conserved across species, downstream signaling pathways might differ, potentially causing species-specific responses to receptor activation.

  • Physiological role: The relative importance of NPY5R in regulating feeding behavior versus other NPY receptor subtypes may vary between species. In guinea-pigs, both Y1 and Y5 receptors mediate NPY-induced food intake , but the relative contribution of each receptor might differ in pigs or humans.

Understanding these species differences is crucial for proper interpretation of translational studies and should guide the selection of appropriate animal models based on the specific research question.

How do feeding behaviors mediated by NPY5R in pigs compare to those in other mammalian models?

Based on the available research on NPY receptors across mammalian species, several insights about NPY5R-mediated feeding behaviors can be inferred:

  • Role in food intake: In guinea-pigs, rats, and mice, NPY is one of the most potent stimulants of food intake . Both Y1 and Y5 receptors appear to mediate this effect across multiple mammalian species . Given the evolutionary conservation of this system, pigs likely share this fundamental response.

  • Receptor antagonism effects: When Y5 antagonists like CGP 71683A are administered, the feeding response to NPY is attenuated in guinea-pigs . This suggests that Y5R plays a non-redundant role in NPY-stimulated feeding across mammals, likely including pigs.

  • Peptide specificity: Different NPY-related peptides show varied effects on feeding behavior based on their receptor selectivity. NPY, PYY, and (Leu31,Pro34)NPY stimulated feeding in guinea-pigs, while NPY(13-36) had no effect . These peptide-specific responses are likely conserved in pigs due to the similar receptor pharmacology across species.

  • Comparative physiology: As omnivorous animals with similar digestive physiology to humans, pigs may exhibit NPY5R-mediated feeding behaviors that more closely resemble human responses than those seen in rodent models, particularly in terms of meal patterning and dietary preferences.

The study by Lecklin et al. (2002) concluded that "NPY stimulates feeding in guinea-pigs through Y1 and Y5 receptors. As the guinea-pig is very distantly related to the rat and mouse, this suggests that both Y1 and Y5 receptors may mediate NPY-induced hyperphagia also in other orders of mammals" . This finding suggests that similar mechanisms likely operate in pigs as well.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.