Recombinant Pig Oxytocin receptor (OXTR)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

The Recombinant Pig Oxytocin Receptor (OXTR) is a genetically engineered protein that replicates the native oxytocin receptor found in pigs (Sus scrofa). OXTR belongs to the G-protein-coupled receptor (GPCR) family, specifically coupled with Gαq/11 proteins, and mediates signal transduction upon binding oxytocin (OXT). This receptor plays critical roles in social behavior, reproductive functions (e.g., uterine contractions and lactation), and metabolic regulation . Recombinant OXTR is widely used to study its structural, functional, and pharmacological properties in vitro.

Protein Characteristics

  • Gene: OXTR (Ensembl ID: ENSSSCG00000021585) .

  • Amino Acid Sequence: Full-length (1-386 residues) with a His-tag at the N-terminus .

  • Molecular Weight: ~43 kDa (calculated based on sequence) .

  • Post-Translational Modifications: None reported in bacterial expression systems .

Expression and Purification

Recombinant pig OXTR is typically expressed in Escherichia coli and purified via affinity chromatography. Key specifications include:

ParameterDetails
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C
ReconstitutionSterile deionized water; 0.1–1.0 mg/mL with 50% glycerol for stability

Source: Creative BioMart

Role in Reproduction

  • Seminal Plasma OXT: Elevated OXTR activation in pig seminal plasma correlates with improved in vivo fertility outcomes, enhancing sperm transport via uterine contractions .

  • Myometrial Contractions: OXTR agonists are used in swine artificial insemination to accelerate sperm progression into the uterus, increasing farrowing rates .

Signaling Pathways

OXTR activation triggers:

  1. Phospholipase C (PLC) stimulation, leading to intracellular calcium mobilization .

  2. MAP kinase cascade activation, influencing gene regulation and cellular proliferation .

  3. RhoA/ROK pathway modulation, critical for cytoskeletal reorganization .

Pharmacological Studies

Recombinant OXTR is used to:

  • Screen OXTR agonists/antagonists for therapeutic development.

  • Study receptor-ligand binding kinetics (e.g., equilibrium dissociation constant, KdK_d) .

Genetic Variants and Binding Dynamics

  • V281M/E339K Mutations: Reduce OXTR surface localization and OXT response. Simulations suggest 2.5-fold higher OXT doses can transiently restore signaling .

  • Binding Affinity: Meta-analysis reveals species-specific KdK_d values (e.g., 1.48 nM global mean) .

Metabolic Regulation

  • Pancreatic β-Cells: OXTR deletion in mice abolishes OXT-stimulated insulin secretion, implicating OXTR in glucose homeostasis .

Challenges and Future Directions

  • Expression Limitations: Bacterial systems lack mammalian post-translational modifications, potentially altering receptor function .

  • Therapeutic Potential: OXTR-targeted drugs may treat social disorders (e.g., autism) or reproductive dysfunctions, but interspecies differences require validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify this requirement during order placement. We will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate this to us, and we will prioritize developing the specified tag.
Synonyms
OXTR; Oxytocin receptor; OT-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MEGVLAANWSAEAVNSSAAPPEAEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRALRRPADRLAVLATWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAEAA EAIAGTEGAAAGSRGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWS VWDADAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSSSHLKTSRPG ETSVSKKSNSSTFVLSQHSSSQKSCS
Uniprot No.

Target Background

Function
Oxytocin receptor (OXTR) acts as a receptor for oxytocin. Its activity is mediated by G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Database Links

KEGG: ssc:397092

STRING: 9823.ENSSSCP00000023004

UniGene: Ssc.108

Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the porcine oxytocin receptor and how does it compare to other mammalian species?

The porcine oxytocin receptor (OXTR) is a class I G protein-coupled receptor primarily coupled via Gq proteins to phospholipase C-β. Similar to other mammalian OXTRs, the high-affinity receptor state requires both Mg²⁺ and cholesterol, which likely function as allosteric modulators . The agonist-binding region differs from the antagonist binding site, as characterized through mutagenesis and molecular modeling studies. The receptor contains a β-barrel structure formed of aromatic or aliphatic chains with a few polar non-charged residues, linked to an α-helical domain. Unlike some other binding proteins, the porcine OXTR does not undergo conformational changes upon binding with odorants .

How is the pig OXTR gene regulated and expressed in different tissues?

The pig OXTR gene expression is strongly steroid-dependent, though this dependency is only partially reflected in the promoter sequences of the OXTR gene . The 5′ promoter/enhancer region contains predicted binding sites for activator protein 1, SP1, and progesterone receptor (PGR), but notably lacks estrogen receptor α (ESR1) binding sites . In pigs, OXTR expression has been identified in multiple tissues, including uterine endometrial luminal epithelia (LE), pancreatic islets (in α-, β-, and δ-cells), salivary glands, and various regions of the brain . Deletion analysis shows that basal promoter activity depends on the region from −144 to −4 bp containing only SP1 sites, with mutations in proximal SP1 sites affecting both ESR1 action and basal promoter activity .

What are the most effective methods for producing recombinant pig OXTR for experimental studies?

Recombinant pig OXTR can be effectively produced using several expression systems, with E. coli being commonly employed for initial structural and binding studies. When comparing recombinant versus native OXTR, researchers should consider that bacterial expression systems lack the post-translational modifications present in native proteins. Studies have shown that recombinant OXTR produced in E. coli and native OXTR purified from mandibular glands displayed comparable affinities for tested ligands, despite differences in glycosylation .

For functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems such as HEK293T cells are preferred. These systems allow for the expression of various OXTR genetic variants to study their impact on receptor localization and function. Cell-specific parameters must be considered, as surface expression levels of OXTR can vary significantly between cell types and among genetic variants .

How can researchers visualize and quantify OXTR expression in porcine tissues?

Several methodologies are available for detecting OXTR expression in porcine tissues:

  • In situ hybridization using RNAscope Multiplex Fluorescent assays allows visualization of OXTR mRNA in specific cell types. This technique is particularly valuable for co-localization studies with other markers such as insulin, glucagon, and somatostatin .

  • Custom probes spanning specific regions of the OXTR gene can be designed to evaluate expression in control and knockout animals. For example, studies have used custom probes that span regions removed by Cre recombinase in OXTR knockout models .

  • Fluorescence labeling techniques using specific fluorophores (e.g., Opal 570 nm, 520 nm, 650 nm) can help visualize expression patterns in fixed tissue sections .

  • Immunohistochemistry using specific antibodies against OXTR can localize the protein in various tissues, as demonstrated in studies examining OXTR in porcine brain tissue in response to acute brain injury .

How do genetic variants of pig OXTR affect its binding dynamics with oxytocin?

Genetic variants of OXTR can significantly alter OXT-OXTR binding dynamics, affecting both receptor surface localization and downstream signaling. Research on human OXTR variants (which can inform pig OXTR studies) shows that variants like P108A and L206V can increase OXTR complex formation by 58% and 81% respectively, while variants V281M and E339K can decrease complex formation by 55% and 29% .

The altered binding dynamics result from:

  • Differential surface localization: Some variants show reduced surface expression, limiting the availability of receptors for oxytocin binding.

  • Modified binding kinetics: Variants may exhibit different association (kon) and dissociation (koff) rates with oxytocin.

  • Cell-type specific effects: The impact of genetic variants on OXTR binding dynamics varies between cell types, with differences in binding kinetics observed between HEK293T cells and myometrial cells .

Mathematical modeling approaches can predict how these genetic variants affect OXT-OXTR complex formation at different oxytocin concentrations and time points, providing insights into potential dosing strategies to rescue reduced OXTR activation .

What methods are used to measure OXTR activation and signaling in recombinant systems?

Several methodological approaches can be employed to assess OXTR activation and signaling:

  • Insulin secretion assays: In isolated pancreatic islets, OXTR activation by oxytocin leads to potentiated insulin secretion under high glucose conditions. This can be measured to assess functional OXTR activity, as demonstrated in studies comparing wildtype and β-cell OXTR knockout mice .

  • Calcium mobilization assays: Since OXTR couples to Gq proteins and activates phospholipase C-β, resulting in intracellular calcium release, calcium fluorescence imaging can be used to measure receptor activation within seconds after oxytocin administration .

  • Dose-response curves: Constructing dose-response curves with oxytocin concentrations ranging from picomolar to micromolar allows determination of EC50 values. For example, studies have calculated an EC50 of 4.71 nM oxytocin for wildtype OXTR in HEK293T cells, which aligns with the experimentally measured EC50 for OXTR activation (5.4 nM) .

  • Fluorescent-based binding assays: These can be used to compare binding affinities between recombinant and native OXTR, especially when studying the effects of post-translational modifications .

How does pig OXTR differ functionally from mouse and human OXTR models?

Pig OXTR exhibits several key differences from mouse and human models:

  • Species-specific binding kinetics: The association and dissociation rates of oxytocin with OXTR vary across species. These differences influence the EC50 values, with distinct binding patterns observed in porcine, human, and murine models .

  • Physiological response variations: In mice, knockout studies have confirmed the essential role of oxytocin for milk let-down reflexes, but its role in parturition appears more complex across species. In pigs, oxytocin administration during labor shows different effects depending on timing, with variable impacts on piglet survival .

  • Receptor distribution: While many tissues express OXTR across species, the patterns and relative abundance vary. In pigs, significant OXTR expression is found in salivary glands where it interacts with pheromone-binding proteins, a feature less prominent in mice .

  • Physiological context: In pigs, oxytocin is widely used in swine farms to complement normal parturition, but timing is critical. Administration at the beginning of labor can lead to different outcomes than later administration, affecting piglet mortality and physiological parameters .

What are the implications of using recombinant pig OXTR as a model for human OXTR studies?

Pigs provide valuable models for human OXTR studies due to several factors:

  • Anatomical similarities: Pigs and humans share similarities in brain anatomy, size, gyrencephalic organization, and skull structure, making pigs highly relevant for translational medicine, particularly in studying neurotrauma and cerebral physiology related to oxytocin .

  • Reproductive physiology: Both species show steroid-dependent regulation of OXTR, making pigs suitable models for reproductive studies involving oxytocin .

  • Binding kinetics comparisons: Mathematical modeling studies show that OXTR binding dynamics can be mapped across species, allowing researchers to predict how findings in pig models might translate to human applications. For example, a 20- to 30-fold increase in binding affinity can rescue OXTR complex formation in certain genetic variants, a principle potentially applicable across species .

  • Limitations: Researchers should note species-specific differences in OXTR post-translational modifications, binding affinities, and tissue distribution patterns when extrapolating from pig to human studies .

How can researchers effectively design knockout models to study pig OXTR function?

Effective knockout model design for pig OXTR requires careful consideration of several factors:

  • Tissue-specific targeting: As demonstrated with the β-cell-specific OXTR knockout, targeted deletion allows focused study of OXTR function in specific tissues while minimizing systemic effects. This approach revealed that approximately 40% of total islet OXTR expression in control mice occurs in β-cells .

  • Verification methods: Multiple verification approaches should be employed:

    • In situ RNA hybridization to confirm absence of OXTR expression in targeted cells

    • Functional assays (e.g., insulin secretion in response to oxytocin) to confirm loss of OXTR-mediated effects

    • Quantification of OXTR expression in knockout versus control tissues

  • Control considerations: When designing knockout studies, researchers should preserve OXTR function in non-targeted cells to serve as internal controls. For example, in β-cell OXTR knockout models, OXTR expression remained intact in non-insulin expressing cells, allowing comparison of effects within the same tissue .

  • Phenotypic characterization: Comprehensive assessment should include both molecular (receptor expression) and functional (physiological response) parameters to fully characterize the knockout model .

What are the methodological considerations for studying post-translational modifications of pig OXTR?

Post-translational modifications significantly impact OXTR function and require specific methodological approaches:

  • Phosphorylation analysis: Phosphorylation generates different OXTR isoforms with varying binding affinities. Mapping phosphorylation sites using CID-nanoLC-MS/MS has identified specific sites (e.g., S13 and T122) that influence binding specificity .

  • Glycosylation assessment: N-glycosylation occurs at specific sites (e.g., Asp53) in porcine salivary OXTR-related proteins. While glycosylation may not directly affect internal ligand binding, it likely influences protein-protein interactions, including dimer formation or interaction with olfactory receptors .

  • O-GlcNAcylation analysis: This modification has been identified at sites S13 and S19 in porcine olfactory binding proteins related to OXTR. Comparing binding properties of differentially modified forms can reveal how these modifications tune binding specificity .

  • Isoform separation: Multiple isoforms resulting from post-translational modifications (e.g., nine isoforms for VEGP, seven for SAL, and 12 for OBP in porcine nasal mucus) should be separated and characterized individually to understand their specific functions .

  • Comparative assays: Binding assays comparing recombinant proteins (with controlled modifications) and native proteins (with natural modifications) can reveal the functional significance of specific post-translational modifications .

How does recombinant OXTR research inform understanding of piglet response to weaning stress?

OXTR research provides insights into piglet stress responses during weaning:

  • Administration studies: Research has investigated oxytocin administration effects on weaning response, comparing intranasal versus subcutaneous routes. While oxytocin had limited effects on physiological stress responses, it increased the frequency of mild aggressive social behaviors, suggesting complex behavioral effects .

  • Dosage considerations: Studies testing 10 International Units per kg of body weight (equivalent to 21 μg per kg) administered subcutaneously found that treatment before weaning affects post-weaning adaptation. Previous research showed that daily oxytocin administration during the first two weeks of life resulted in lower weight loss over the first two days post-weaning .

  • Administration methods: The research demonstrates specific methodological approaches, including use of a Mucosal Atomizer Device for intranasal delivery with the pig maintained in a head-up position, and subcutaneous injection in the neck area behind the ear .

  • Developmental context: The developmental timing of oxytocin exposure appears critical, with different effects observed for chronic neonatal administration versus acute administration immediately prior to weaning .

What are the physiological considerations when using oxytocin in pig labor management, and how does OXTR function contribute to these effects?

Oxytocin administration during pig labor requires careful physiological considerations:

How should researchers interpret contradictory data on OXTR function across different experimental models?

When faced with contradictory data on OXTR function, researchers should:

  • Consider cell-type and tissue-specific effects: OXTR function varies significantly across tissues. For example, studies show that oxytocin potentiates insulin secretion under high glucose conditions but has no effect under low glucose conditions in pancreatic β-cells .

  • Evaluate species differences: While knockout studies in mice have clarified oxytocin's role in milk let-down, its role in parturition appears more complex across species. In pigs, oxytocin administration during labor produces variable outcomes depending on timing and dosage .

  • Account for experimental conditions: The binding dynamics of OXT-OXTR complexes are highly dependent on experimental conditions including oxytocin concentration, exposure duration, and cell type. Mathematical modeling shows that EC50 values for OXT-OXTR binding in HEK293T cells (4.71 nM) differ from those in human myometrial cells (14.5 nM) .

  • Consider developmental and physiological contexts: OXTR function changes with developmental stage and physiological state. In female reproduction, the same pheromones mediated by OXTR-related proteins may be perceived differently depending on reproductive status .

  • Analyze post-translational modification effects: Different OXTR isoforms resulting from post-translational modifications show variable binding specificity. Some isoforms are tuned to specific ligands (e.g., androstenol and androstenone), which may explain functional differences observed across studies .

What are the most significant methodological challenges in recombinant pig OXTR research?

Key methodological challenges include:

  • Post-translational modification replication: Recombinant expression systems often fail to reproduce the complex pattern of post-translational modifications found in native OXTR. While bacterial recombinant OXTR may show similar ligand binding properties to native proteins, they lack modifications that might affect protein-protein interactions or receptor complex formation .

  • Cell-surface localization variability: Genetic variants of OXTR show differential surface localization, complicating the interpretation of binding studies. Mathematical modeling approaches must account for cell-type specific and variant-specific OXTR concentrations .

  • Binding kinetics characterization: Association (kon) and dissociation (koff) rates vary significantly by cell type, species, and even gestational status. These parameters must be carefully measured and incorporated into experimental designs and data interpretation .

  • Tissue-specific knockout verification: Confirming complete deletion of OXTR in targeted tissues requires multiple approaches, including in situ hybridization, protein detection, and functional assays, to ensure the validity of knockout models .

  • Distinguishing direct vs. indirect effects: Oxytocin has diverse physiological effects beyond its classical roles in labor and lactation, including influences on social behavior, stress responses, and metabolism. Determining which effects are directly mediated by OXTR versus secondary to other systems remains challenging .

  • Translating between in vitro and in vivo findings: While in vitro studies allow precise control of experimental conditions, translating these findings to in vivo contexts requires accounting for the complex physiological environment in which OXTR functions .

What are promising new methodologies for studying recombinant pig OXTR binding dynamics?

Several innovative approaches show promise for advancing pig OXTR research:

  • Mathematical modeling of binding dynamics: Developing comprehensive models that incorporate cell-specific parameters such as OXTR surface concentration, association and dissociation rates, and the effects of genetic variants can predict OXT-OXTR complex formation under various conditions. These models can inform experimental design and help interpret complex binding data .

  • Fluorescent-based real-time binding assays: Using fluorescent probes like 1-aminoanthracene in competitive binding assays allows real-time monitoring of ligand-receptor interactions. This approach has revealed that androstenone efficiently binds with isoforms of OXTR-related proteins by replacing the fluorescent probe .

  • Combined imaging and functional assays: Integrating in situ hybridization with functional measurements (e.g., calcium imaging, insulin secretion) in the same experimental system can provide insights into the relationship between OXTR expression patterns and physiological function .

  • Temporal dynamics exploration: Investigating the time-dependent aspects of OXTR activation can reveal critical windows for intervention. For example, mathematical modeling suggests that some OXTR genetic variants can achieve wildtype-level activation within the first 20 seconds of oxytocin administration, despite showing reduced activation at equilibrium .

  • Interdisciplinary approaches: Combining techniques from molecular biology, biophysics, computational modeling, and physiology can provide a more comprehensive understanding of OXTR function across different biological contexts .

How might recombinant pig OXTR research contribute to understanding the interaction between OXTR and other physiological systems?

Recombinant pig OXTR research offers opportunities to explore complex system interactions:

  • OXTR and hydrogen sulfide (H2S) system: Research has identified interactions between the oxytocin/oxytocin receptor system and the H2S-producing enzymes in the context of brain injury. Both systems are implicated in vascular protection and regulation of fluid homeostasis, suggesting cooperative functions in response to trauma .

  • OXTR and pheromone signaling: In pigs, OXTR-related binding proteins in saliva and nasal mucus interact with steroidal pheromones (androstenone and androstenol). Understanding how these systems interact could provide insights into social and reproductive behaviors regulated by both oxytocin and pheromones .

  • OXTR and glucose metabolism: Research on pancreatic β-cell-specific OXTR knockout models has revealed important roles for OXTR in insulin secretion regulation. This suggests potential interactions between the oxytocin system and metabolic regulation pathways .

  • OXTR and neuro-inflammatory processes: Studies in porcine brain tissue have localized OXTR in neurons, vasculature, and parenchyma at the base of sulci, where pressure-induced injury leads to maximal stress. This suggests roles for OXTR in modulating neuroinflammatory responses to brain injury .

  • OXTR and steroid hormone signaling: The regulation of OXTR gene expression is strongly steroid-dependent, with complex interactions between estrogen, progesterone, and oxytocin signaling pathways. Recombinant systems allow controlled study of these interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.