Recombinant Pig P2Y purinoceptor 2 (P2RY2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

P2RY2 is a purinergic receptor encoded by the P2RY2 gene, part of the P2Y receptor family that mediates responses to nucleotides. In pigs, it is expressed in vascular smooth muscle cells (VSMCs) and other tissues, where it regulates intracellular calcium mobilization and mitogen-activated protein kinase (MAPK) signaling . Its recombinant form enables controlled study of receptor-ligand interactions and downstream effects in experimental models.

Recombinant Production

Recombinant porcine P2RY2 is typically produced in E. coli or mammalian expression systems. Key specifications include:

  • Expression System: E. coli with N-terminal His-tag for purification .

  • Purity: >90% (verified by SDS-PAGE) .

  • Storage: Lyophilized powder stable at -80°C; reconstituted in Tris/PBS buffer with trehalose .

Example Protocol:

  1. Gene Cloning: Full-length P2RY2 cDNA (1,119 bp) is amplified from porcine coronary artery RNA .

  2. Expression: Transfected into E. coli BL21 cells under optimized induction conditions .

  3. Purification: Nickel-affinity chromatography for His-tagged protein .

Pharmacological Profile

The porcine P2RY2 receptor exhibits unique agonist selectivity:

  • Primary Agonists: UTP > ATP (contrasts with human P2RY2, which responds equally to both) .

  • Antagonists: AR-C118925 (non-competitive inhibitor; pIC₅₀ ~7.24) .

Agonist Potency (pEC₅₀)Porcine P2RY2Human P2RY2
UTP7.227.22
ATP7.077.07
2-MeSADP5.605.60

Cloning and Up-Regulation

  • Porcine P2RY2 mRNA is upregulated in VSMCs from stented coronary arteries and organ-cultured vessels, linking it to vascular injury responses .

  • Mechanism: Promotes VSMC proliferation via ERK phosphorylation and calcium signaling .

Functional Studies

  • Mitogenic Role: ATP/UTP activation enhances VSMC proliferation, a key factor in atherosclerosis and restenosis .

  • Metabolic Impact: Knockout models show resistance to diet-induced obesity, suggesting roles in lipid metabolism .

Applications in Research

  • Vascular Disease Models: Used to study coronary artery stent angioplasty outcomes .

  • Drug Development: Screening for antagonists (e.g., AR-C118925 derivatives) to target inflammatory and fibrotic diseases .

  • Signal Transduction: Elucidating GPCR-mediated pathways in VSMCs and adipocytes .

Future Directions

  • Therapeutic Targeting: P2RY2 antagonists may treat obesity, diabetes, and vascular remodeling .

  • Structural Studies: Cryo-EM analysis to resolve ligand-binding dynamics in porcine vs. human receptors .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
P2RY2; P2Y purinoceptor 2; P2Y2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MATGPDLWNGTVNGTSDGDDWGYRCRFHEDFKYVLLPLSYGVVCVLGLSLNAGALYIFLC RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTALCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLRSLRWGHARYARRVAAAVWGLVLACQAPALYFITTTAQGGR ITCHDTSAPELFSHFVAYSLVMLSVLFAAPFAVILVCYALMARRLLRPAYGTAGGLPRAK RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRTLDLSCHTLDAINMAYKITRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTDATPTAQACRRLGLRRSHGTDTKRTEDSASSEDSRR TEITPARGEDIRL
Uniprot No.

Target Background

Function
P2Y2, the receptor for ATP and UTP, is coupled to G-proteins and activates a phosphatidylinositol-calcium second messenger system. The affinity range for these ligands is UTP > ATP.
Gene References Into Functions
  1. The effect of ATP on Na+-ATPase activity may be involved in antinatriuresis induced by the P2Y4 receptor or a mechanism to counterbalance the natriuretic effect of the P2Y2 receptor. This suggests a role in fine-tuning sodium reabsorption in proximal tubule cells. PMID: 23567840
Database Links

KEGG: ssc:450248

UniGene: Ssc.42768

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in heart, kidney, intestine, skeletal muscle and adrenal gland.

Q&A

What is the P2Y2 receptor and how does it function in porcine tissues?

The P2Y2 receptor is a G protein-coupled receptor (GPCR) activated by extracellular adenine and uridine nucleotides, particularly ATP and UTP with equal potency. In porcine tissues, P2Y2 receptors primarily couple to Gq proteins, activating phospholipase C-beta (PLC-β) . Additionally, they can couple to G12 proteins to activate Rho pathways . P2Y2 receptors are widely expressed in porcine tissues, with particularly strong evidence for their presence in coronary arteries where they mediate smooth muscle contraction in response to UTP . The receptor functions through multiple signaling pathways, including calcium mobilization, which is commonly used as a functional readout in pharmacological studies .

How does porcine P2Y2 receptor structure compare to human P2Y2 receptors?

Porcine P2Y2 receptors share significant structural homology with human P2Y2 receptors, featuring the characteristic seven transmembrane domains typical of GPCRs. Both have an extracellular N-terminus containing potential glycosylation sites, three intracellular loops that couple to heterotrimeric G proteins, and an intracellular C-terminus with binding/phosphorylation sites for protein kinases . While specific amino acid sequence variations exist between species, the ligand binding pocket structure is highly conserved, explaining why both porcine and human P2Y2 receptors show similar pharmacological profiles with agonists like UTP and ATP . This structural similarity makes porcine models valuable for translational research on P2Y2-targeted therapies.

What are the recommended methods for detecting P2Y2 receptor expression in porcine tissues?

Multiple complementary approaches should be employed for reliable detection of P2Y2 receptor expression in porcine tissues:

  • RT-PCR: Use specific primers targeting the porcine P2Y2 receptor gene. This technique can identify predominant expression of P2Y2 receptors, as demonstrated in porcine coronary artery studies .

  • Immunoblot analysis: Western blotting with validated antibodies against P2Y2 receptors can confirm protein expression, though cross-reactivity must be carefully controlled. Previous studies have shown variable immunoreactivity for P2Y2 receptors in porcine tissues .

  • Functional assays: Calcium mobilization assays using fluorescent indicators like Cal-520 can demonstrate functional expression by measuring intracellular Ca²⁺ responses to selective P2Y2 agonists like UTP or MRS 2768 .

  • Pharmacological profiling: Comparing response profiles to UTP, ATP, and selective antagonists like AR-C118925XX can help identify functional P2Y2 receptors .

For reliable detection, a combination of these methods is recommended as each has limitations when used alone.

How should I design experiments to specifically target pig P2Y2 receptors and differentiate them from other P2Y receptor subtypes?

Designing experiments to specifically target porcine P2Y2 receptors requires a strategic approach combining pharmacological tools and controls:

  • Selective agonists: Use P2Y2-selective agonists such as MRS 2768 or 2-ThioUTP, which exhibit greater selectivity for P2Y2 versus other P2Y receptor subtypes . ATP and UTP activate P2Y2 with equal potency, distinguishing them from P2Y4 receptors where UTP > ATP .

  • Selective antagonist: AR-C118925XX is currently the only selective P2Y2 antagonist available and should be used at concentrations from 10 nM to 1 μM. It produces a rightward shift in agonist concentration-response curves without decreasing maximum response, consistent with competitive antagonism .

  • Control experiments: Include experiments in cell systems lacking P2Y2 receptors to control for off-target effects. AR-C118925XX (1 μM) has been shown to have no effect on hP2Y1, hP2Y4, rP2Y6, or hP2Y11 receptors .

  • Concentration-response relationships: Construct full agonist concentration-response curves with and without antagonist pretreatment to demonstrate competitive antagonism. This approach allows calculation of antagonist affinity and confirms P2Y2 involvement .

  • Validation with multiple response readouts: Measure both calcium signaling and downstream effects such as smooth muscle contraction to confirm receptor identity .

By combining these approaches, you can reliably identify and study P2Y2-mediated responses in porcine tissue preparations.

What are the optimal expression systems for studying recombinant pig P2Y2 receptors?

For optimal expression and characterization of recombinant pig P2Y2 receptors, several expression systems can be employed, each with specific advantages:

  • 1321N1 astrocytoma cells: These cells are preferred because they lack endogenous P2Y receptors, providing a "clean" background for studying recombinant receptors. They have been successfully used to characterize human P2Y2 receptors and allow for direct comparison with porcine receptors .

  • HEK293 cells: While they express some endogenous P2 receptors, they offer high transfection efficiency and robust protein expression. Control experiments with mock-transfected cells are essential to account for endogenous responses.

  • CHO cells: These cells provide stable expression and are suitable for establishing clonal cell lines with defined receptor density.

For any expression system, consider these methodological approaches:

  • Use inducible expression systems to control receptor expression levels

  • Generate stable cell lines for consistent results across experiments

  • Perform cloning by limiting dilution to isolate clones with optimal expression levels

  • Validate receptor expression using techniques like western blotting

For calcium mobilization assays, plate cells at a density of 10,000-15,000 cells per well in 384-well plates to achieve optimal confluency for fluorescence measurements .

What are the most reliable functional assays for characterizing recombinant pig P2Y2 receptor pharmacology?

The most reliable functional assays for characterizing recombinant pig P2Y2 receptor pharmacology include:

  • Calcium mobilization assays: This is the gold standard for P2Y2 receptor characterization. Using fluorescent calcium indicators like Cal-520, researchers can monitor real-time changes in intracellular calcium in response to agonists . The assay should include:

    • Continuous superfusion systems to enable construction of full concentration-response curves on a single population of cells

    • Control for cell density (10,000-15,000 cells per well for 384-well plates)

    • Appropriate dye loading protocols (typically 1-2 hours)

    • Proper ligand preparation to prevent degradation

  • Measurement of inositol phosphate accumulation: Since P2Y2 couples to Gq and activates PLC-β, measuring IP3 or its metabolites provides a direct readout of receptor activity.

  • ERK1/2 phosphorylation assays: These detect downstream signaling and can reveal biased agonism at P2Y2 receptors.

  • Tissue-based contractility assays: For physiological relevance, measure UTP-induced contractions in isolated porcine arteries. In coronary arteries, UTP-evoked contractions (predominantly P2Y2-mediated) are inhibited by suramin but not PPADS, providing a pharmacological signature .

When performing these assays, it's crucial to include:

  • Full agonist concentration-response curves (10 nM to 100 μM)

  • Antagonist studies with pre-incubation periods of at least 15-30 minutes

  • Positive controls using endogenous ligands (ATP, UTP)

  • Vehicle controls to account for mechanical stimulation

How can I investigate potential heteromerization between pig P2Y2 receptors and other P2Y receptor subtypes?

Investigating heteromerization between pig P2Y2 receptors and other P2Y receptor subtypes requires sophisticated approaches:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of P2Y2 and candidate partner receptors (e.g., P2Y1, P2Y11) in a heterologous expression system. Following immunoprecipitation with an antibody against one receptor, probe for the presence of the partner receptor. This approach has provided evidence for potential P2Y1:P2Y11 heteromers .

  • Resonance energy transfer techniques:

    • Bioluminescence resonance energy transfer (BRET): Tag P2Y2 with Renilla luciferase and the partner receptor with a fluorescent protein

    • Fluorescence resonance energy transfer (FRET): Tag both receptors with compatible fluorophores
      These techniques allow real-time monitoring of receptor interactions in living cells.

  • Functional pharmacology: Look for unique pharmacological profiles that emerge when multiple receptors are co-expressed. For example, biphasic concentration-response curves may indicate heteromer formation, as seen with P2Y1 and P2Y11 receptors where both high and low-affinity binding sites were observed .

  • Signaling studies: Investigate whether co-expression alters canonical signaling pathways. For instance, if P2Y2 typically signals through Gq, determine whether co-expression with another receptor introduces Gi coupling or altered calcium responses.

  • Proximity ligation assay (PLA): This technique can visualize receptor interactions in native tissues and cells, providing evidence of heteromerization in physiologically relevant contexts.

When designing these experiments, include appropriate controls such as non-interacting receptor pairs and ensure equivalent expression levels of both receptors to avoid artifacts from overexpression.

What strategies can be employed to study the conformational changes of pig P2Y2 receptors during activation?

Studying conformational changes in pig P2Y2 receptors during activation requires techniques that can capture dynamic structural alterations:

  • Site-directed fluorescence labeling: Introduce cysteine residues at strategic positions in the receptor and label them with environment-sensitive fluorophores. Changes in fluorescence properties upon agonist binding can indicate conformational changes in specific receptor domains.

  • Intramolecular FRET sensors: Engineer pig P2Y2 receptors with fluorescent proteins or smaller fluorophores at positions that undergo relative movement during activation, such as the third intracellular loop and C-terminus. FRET efficiency changes correlate with conformational changes.

  • Accessibility studies: Use methionine substitution and cyanogen bromide cleavage or cysteine substitution and accessibility to thiol-reactive reagents to probe changes in the exposure of specific receptor regions upon activation.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of the receptor that undergo changes in solvent accessibility upon ligand binding, indicating conformational changes.

  • Molecular dynamics simulations: Using homology models based on the known structures of related GPCRs (such as the P2Y1 receptor), simulate conformational changes induced by different ligands. The P2Y1 receptor structure shows distinct conformational states when bound to different ligands, which may be similar for P2Y2 .

  • Binding studies with conformation-specific antibodies or nanobodies: These can trap and identify specific receptor conformations associated with different activation states.

When performing these studies, compare the effects of different ligands (full agonists, partial agonists, biased agonists, and antagonists) to develop a comprehensive understanding of the conformational landscape of the pig P2Y2 receptor.

How does the post-translational modification profile of pig P2Y2 receptors affect receptor function and pharmacology?

Post-translational modifications (PTMs) of pig P2Y2 receptors significantly impact receptor function and pharmacology through multiple mechanisms:

  • N-linked glycosylation: P2Y2 receptors contain potential glycosylation sites in their extracellular N-terminus . To study the impact of glycosylation:

    • Use site-directed mutagenesis to eliminate N-glycosylation sites

    • Treat cells with tunicamycin to inhibit N-glycosylation

    • Analyze receptor expression, trafficking, and agonist potency before and after these interventions

  • Phosphorylation: The intracellular C-terminus of P2Y2 contains multiple phosphorylation sites for protein kinases . To investigate these:

    • Use phospho-specific antibodies to detect basal and agonist-induced phosphorylation

    • Create phospho-deficient mutants by replacing serine/threonine residues with alanine

    • Employ phosphomimetic mutations (serine/threonine to aspartate/glutamate)

    • Measure the impact on receptor desensitization, internalization, and signaling

  • Palmitoylation: This lipid modification can anchor portions of the receptor to the membrane. Investigate using:

    • Metabolic labeling with palmitic acid analogs

    • Site-directed mutagenesis of putative palmitoylation sites

    • Treatment with palmitoylation inhibitors

  • Ubiquitination: This modification often targets receptors for degradation. Examine by:

    • Immunoprecipitation followed by ubiquitin-specific western blotting

    • Proteasome inhibitor treatments to assess effects on receptor turnover

Each of these PTMs can affect:

  • Receptor trafficking to the plasma membrane

  • Ligand binding affinity and selectivity

  • G protein coupling efficiency

  • Desensitization and internalization kinetics

  • Receptor half-life

When studying these modifications, it's important to compare the PTM profile in recombinant systems with that in native porcine tissues to ensure physiological relevance of your findings.

How do the pharmacological properties of pig P2Y2 receptors compare with those of human and other species?

The pharmacological properties of pig P2Y2 receptors show both similarities and important differences when compared to human and other species:

SpeciesAgonist PotencyAntagonist SensitivityG Protein CouplingKey Differences
PigATP = UTP > ATPγSSensitive to suramin, less sensitive to PPADSPrimarily Gq/11 and G12UTP-evoked contractions in coronary arteries inhibited by suramin but not PPADS
HumanATP = UTP > ATPγSAR-C118925XX acts as potent competitive antagonistGq/11 and G12Well-characterized with selective antagonists like AR-C118925XX
RodentATP = UTPVariable antagonist sensitivityPrimarily Gq/11Species differences in antagonist pharmacology

Key comparative observations:

  • Agonist profiles: Across species, P2Y2 receptors maintain equal potency for ATP and UTP, which distinguishes them from P2Y4 receptors (UTP > ATP) . This conservation suggests the nucleotide binding pocket is highly preserved across species.

  • Antagonist sensitivity: Porcine P2Y2 receptors in coronary arteries show sensitivity to the non-selective antagonist suramin but not PPADS . In contrast, human P2Y2 receptors are potently antagonized by AR-C118925XX, which produces competitive rightward shifts of agonist concentration-response curves .

  • Tissue-specific responses: In porcine tissues, P2Y2 receptor expression appears predominant in coronary arteries compared to ear arteries, where responses to UTP are inhibited by both PPADS and suramin, suggesting a different receptor subtype profile .

  • Receptor reserve: The degree of receptor reserve may differ between species and tissues, affecting the apparent potency of partial agonists.

These interspecies differences are important considerations when using porcine models for developing therapeutics targeting human P2Y2 receptors.

What are the key differences in signal transduction pathways between recombinant and native pig P2Y2 receptors?

Signal transduction pathways can differ significantly between recombinant and native pig P2Y2 receptors due to multiple factors:

  • G protein coupling profile:

    • Recombinant systems: In overexpression systems, pig P2Y2 receptors may couple to multiple G protein subtypes beyond their preferred Gq/11 and G12 partners . This promiscuous coupling can generate signals not typically seen in native tissues.

    • Native receptors: In porcine tissues such as coronary arteries, P2Y2 receptors show more selective G protein coupling, predominantly activating Gq/11 pathways leading to smooth muscle contraction .

  • Signaling efficiency and amplification:

    • Recombinant systems often display enhanced signal amplification due to higher receptor density, resulting in greater sensitivity to agonists.

    • Native receptors typically show more moderate responses that are integrated with other signaling pathways present in the tissue.

  • Scaffold protein interactions:

    • Native P2Y2 receptors interact with tissue-specific scaffold proteins that organize signaling complexes and direct signal transmission.

    • Recombinant systems may lack these scaffold proteins, altering the kinetics and efficiency of signaling.

  • Receptor reserve:

    • Recombinant systems typically have higher receptor reserve due to overexpression, which can mask partial agonism.

    • Native tissues show variable receptor reserve, affecting the apparent efficacy of partial agonists.

  • Regulatory feedback mechanisms:

    • Native systems contain intact regulatory mechanisms including receptor kinases and arrestins.

    • Recombinant systems may have altered expression of these regulatory proteins.

To bridge these differences, researchers should:

  • Titrate expression levels in recombinant systems to match those in native tissues

  • Co-express relevant scaffold proteins and signaling modulators

  • Validate findings from recombinant systems in native tissue preparations

  • Use multiple readouts of receptor activation to capture the full signaling spectrum

How do antagonists like AR-C118925XX interact with pig P2Y2 receptors compared to other P2Y receptor subtypes?

AR-C118925XX demonstrates specific interaction patterns with pig P2Y2 receptors that distinguish them from other P2Y receptor subtypes:

  • Selectivity profile:

    • AR-C118925XX is highly selective for P2Y2 receptors, with no significant effect at 1 μM on P2Y1, P2Y4, P2Y6, or P2Y11 receptors .

    • This contrasts with suramin, which inhibits multiple P2Y subtypes but shows effectiveness against pig P2Y2 receptors in coronary arteries .

    • PPADS does not effectively inhibit pig P2Y2 receptors in coronary arteries, but inhibits UTP responses in ear arteries, suggesting different receptor subtypes .

  • Mechanism of antagonism:

    • AR-C118925XX acts as a competitive antagonist at P2Y2 receptors, causing parallel rightward shifts of agonist concentration-response curves without reducing maximum response .

    • The competitive nature indicates binding at the orthosteric site, unlike allosteric modulators which may be available for other P2Y receptors (e.g., BPTU for P2Y1) .

  • Potency at pig P2Y2 receptors:

    • AR-C118925XX demonstrates nanomolar potency at P2Y2 receptors, with effective concentrations from 10 nM to 1 μM .

    • The antagonism is fully reversible upon washout, indicating non-covalent binding interactions .

  • Binding site interactions:

    • While no crystal structure exists for P2Y2 with AR-C118925XX, comparative modeling based on the P2Y1 structure suggests AR-C118925XX likely interacts with transmembrane domains forming the nucleotide binding pocket .

    • These binding interactions are unique to P2Y2 and explain the selectivity over other P2Y subtypes.

In experimental applications with pig P2Y2 receptors, AR-C118925XX should be used at concentrations ranging from 10-100 nM for selective antagonism, with higher concentrations (1 μM) reserved for complete blockade of the receptor . These concentrations ensure selectivity while providing sufficient antagonism to identify P2Y2-mediated responses.

How should researchers interpret complex concentration-response curves when working with pig P2Y2 receptors?

Interpreting complex concentration-response curves for pig P2Y2 receptors requires careful analysis and consideration of several potential underlying mechanisms:

  • Biphasic responses: When concentration-response curves show two distinct components (high and low affinity), consider:

    • Heterogeneous receptor populations: The high-affinity component may represent P2Y2 receptors, while the low-affinity component might indicate another P2Y subtype or heteromeric receptor complexes .

    • To analyze: Fit data to a two-site model and compare with a one-site model using statistical tests (F-test) to determine if the additional complexity is justified.

  • Shallow Hill slopes (nH << 1):

    • May indicate negative cooperativity, multiple binding sites, or heterogeneous receptor populations

    • Can result from receptor reserve in tissues with high receptor expression

    • Analysis approach: Compare Hill coefficients across tissues and after irreversible receptor inactivation to determine if receptor reserve is responsible

  • Rightward shifts with antagonists:

    • Parallel shifts without maximum depression suggest competitive antagonism (as seen with AR-C118925XX at P2Y2)

    • Calculate pA2 values using Schild analysis to determine antagonist affinity

    • Non-parallel shifts may indicate allosteric modulation or multiple receptor subtypes

  • Bell-shaped curves:

    • May indicate receptor desensitization at high agonist concentrations

    • Could reflect activation of counteracting signaling pathways

    • Analysis approach: Include desensitization-resistant receptor mutants or inhibitors of regulatory kinases to test mechanism

  • Tissue-specific differences:

    • Compare responses in different porcine tissues (e.g., coronary vs. ear arteries)

    • Different antagonist sensitivity profiles can reveal tissue-specific receptor subtypes

    • Analyze using multiple antagonists with known selectivity profiles

For rigorous analysis:

  • Always fit complete concentration-response curves (10-12 concentrations)

  • Use appropriate equations (single-site, two-site, variable slope)

  • Include statistical comparisons of different fitting models

  • Correlate functional findings with receptor expression data from RT-PCR or immunoblotting

What are the common pitfalls in analyzing antagonist studies with pig P2Y2 receptors and how can they be avoided?

When analyzing antagonist studies with pig P2Y2 receptors, researchers should be aware of these common pitfalls and implement strategies to avoid them:

  • Nucleotide degradation by ectonucleotidases:

    • Pitfall: ATP and UTP can be rapidly degraded by ectonucleotidases, leading to apparent antagonism due to reduced agonist concentration.

    • Solution: Include ectonucleotidase inhibitors like ARL67156 in assay buffers, or use metabolically stable analogs like ATPγS . Monitor nucleotide stability using HPLC.

  • Incomplete equilibration with antagonist:

    • Pitfall: Insufficient pre-incubation with antagonists like AR-C118925XX leads to underestimation of potency.

    • Solution: Ensure adequate pre-incubation time (15-30 minutes) and verify equilibrium has been reached by testing multiple incubation periods .

  • Vehicle effects:

    • Pitfall: DMSO or ethanol vehicles at high concentrations can affect receptor function or cell viability.

    • Solution: Keep vehicle concentration below 0.1% and include appropriate vehicle controls.

  • Hemi-equilibrium conditions in dynamic assays:

    • Pitfall: In superfusion or washout studies, antagonist equilibrium may not be maintained, complicating Schild analysis.

    • Solution: Use static incubation systems for accurate affinity determination or account for hemi-equilibrium conditions in calculations .

  • Allosteric effects misinterpreted as competitive antagonism:

    • Pitfall: Some antagonists may appear competitive at low concentrations but show saturable effects at higher concentrations.

    • Solution: Test wide concentration ranges of antagonist and analyze using global fitting to models that can distinguish competitive from allosteric mechanisms.

  • Receptor desensitization confused with antagonism:

    • Pitfall: Repeated agonist application may cause receptor desensitization that resembles antagonism.

    • Solution: Include appropriate time controls and use non-cumulative dosing protocols. In the superfusion system, ensure full recovery between agonist applications .

  • Overlooking species differences:

    • Pitfall: Assuming antagonist potencies determined in human receptors apply equally to pig P2Y2 receptors.

    • Solution: Directly determine antagonist potencies in the porcine system rather than relying on published human data.

By implementing these strategies, researchers can generate more reliable and interpretable data in antagonist studies of pig P2Y2 receptors.

How can researchers distinguish between P2Y2-mediated effects and those of other uracil nucleotide-sensitive receptors in porcine tissues?

Distinguishing P2Y2-mediated effects from those of other uracil nucleotide-sensitive receptors (P2Y4, P2Y6) in porcine tissues requires a multi-faceted approach:

  • Agonist selectivity profiles:

    • P2Y2: ATP = UTP >> UDP

    • P2Y4: UTP > ATP, UDP inactive

    • P2Y6: UDP >> UTP > ATP

    Experimental approach: Compare full concentration-response curves for ATP, UTP, and UDP. Equal potency of ATP and UTP with minimal UDP activity strongly suggests P2Y2 involvement .

  • Selective antagonists:

    • Use AR-C118925XX (10-100 nM) as a selective P2Y2 antagonist

    • Apply MRS 2578 to block P2Y6 receptors

    • Test PPADS sensitivity (P2Y4 and P2Y6 are PPADS-sensitive, while P2Y2 is relatively resistant)

    In porcine coronary arteries, UTP responses are inhibited by suramin but not PPADS, consistent with P2Y2 involvement .

  • Molecular approaches:

    • Use RT-PCR with subtype-specific primers to quantify relative expression levels

    • Employ receptor-specific siRNA to selectively knock down each receptor subtype

    • Apply receptor-selective antibodies for immunohistochemistry or western blotting

  • Tissue-specific expression patterns:

    • Compare responses across different porcine tissues known to express different P2Y receptor profiles

    • Coronary arteries show predominant P2Y2 expression, while ear arteries express multiple uracil nucleotide-responsive receptors

  • Signal transduction mechanisms:

    • Explore coupling to different G proteins and downstream pathways

    • P2Y2 couples primarily to Gq/11 and G12, whereas other subtypes may have different coupling profiles

  • Kinetic analysis:

    • Examine desensitization patterns, which may differ between receptor subtypes

    • Monitor recovery kinetics after repeated agonist application

Using this systematic approach, researchers can confidently attribute observed effects to P2Y2 receptors when:

  • ATP and UTP show equal potency

  • AR-C118925XX produces competitive antagonism

  • Responses are relatively resistant to PPADS

  • RT-PCR confirms P2Y2 expression

  • Functional responses correlate with known P2Y2 signaling pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.