Recombinant Pig PDZK1-interacting protein 1 (PDZK1IP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
PDZK1IP1; MAP17; PDZK1-interacting protein 1; 17 kDa membrane-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
PDZK1IP1
Target Protein Sequence
MSALSLVILGLLMAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAINHFWCQEERE PMNMVMTTGNKADGILIGTEGKYSSMAASFRSNEHENAYENTSEEEGRVHSTPM
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PDZK1IP1 and what are its key characteristics in pigs?

PDZK1IP1 (PDZK1 interacting protein 1), also known as MAP17, is a protein-coding gene found in Sus scrofa (pig). It functions as an interacting partner of PDZK1 and has been characterized as a membrane-associated protein. In pigs, PDZK1IP1 has Entrez Gene ID 414756 and several transcript variants that encode different protein isoforms . The porcine PDZK1IP1 gene encodes a precursor protein that undergoes post-translational modifications. The primary transcript variant has been documented as NM_001001769.1, encoding a PDZK1-interacting protein 1 precursor, while additional isoforms (X1, X2) have been identified through further genomic analysis .

What expression systems are recommended for producing recombinant pig PDZK1IP1?

For recombinant production of pig PDZK1IP1, several expression systems have been validated with varying efficiency depending on research objectives. The most commonly used expression systems include:

Expression SystemAdvantagesLimitationsTag Options
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsHis, GST, Non-tagged
Mammalian cells (HEK293)Native folding, proper post-translational modificationsHigher cost, lower yieldHis, Myc, DDK, Fc, Avi
Insect cellsIntermediate yield, some post-translational modificationsModerate complexityHis, GST

For structural and functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems using HEK293 cells are generally preferred, as they more accurately produce protein with characteristics similar to native pig PDZK1IP1 . Standard vectors such as pcDNA3.1+/C-(K)DYK have been successfully used for expression of the pig PDZK1IP1 ORF sequence .

How should researchers optimize protein extraction protocols for pig PDZK1IP1?

Optimizing protein extraction for pig PDZK1IP1 requires consideration of its membrane-associated properties. The following methodological approach is recommended:

  • Initial tissue disruption should be performed using mechanical homogenization in a buffer containing 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, 1% Triton X-100, and a complete protease inhibitor cocktail.

  • For membrane-associated protein extraction, incorporation of 0.5% sodium deoxycholate to the lysis buffer improves PDZK1IP1 solubilization.

  • Sonication (3 cycles of 15 seconds at 40% amplitude with 30-second intervals on ice) following homogenization enhances extraction efficiency.

  • Centrifugation should be performed at 15,000 × g for 20 minutes at 4°C to separate soluble proteins from insoluble debris.

  • For recombinant protein with affinity tags, appropriate affinity chromatography should be performed (e.g., Ni-NTA for His-tagged proteins), followed by size exclusion chromatography to enhance purity .

This approach yields significantly higher recovery rates compared to standard single-detergent extraction protocols, particularly when working with tissue samples or recombinant systems expressing membrane-associated variants of the protein.

What are the validated methods for assessing PDZK1IP1 functional activity in experimental settings?

Functional activity assessment for PDZK1IP1 should incorporate multiple complementary approaches:

  • Protein-Protein Interaction Assays: Co-immunoprecipitation (Co-IP) or pull-down assays to detect interactions with known binding partners such as COPS6, ZDHHC17, and UTP14A . These interactions serve as positive controls for proper protein folding and function.

  • ROS Production Measurement: Since MAP17 (PDZK1IP1) functions as an inducer of DNA damage through reactive oxygen species (ROS) increase , quantitative measurement of ROS levels using fluorescent probes such as H2DCFDA in cells expressing recombinant PDZK1IP1 can verify functional activity.

  • Downstream Signaling Assessment: Monitoring phosphorylation of H2AX at Ser139 (pH2AX) as a downstream marker of PDZK1IP1 activity, as these markers have been shown to be functionally related in multiple tissue contexts .

  • Localization Studies: Immunofluorescence or subcellular fractionation to confirm proper membrane localization, which is essential for PDZK1IP1 function.

Each of these methods provides complementary data on different aspects of PDZK1IP1 functionality, and researchers should select approaches most relevant to their specific research questions.

How can pig PDZK1IP1 expression data be integrated with disease resilience studies in porcine models?

Integration of PDZK1IP1 expression data with disease resilience studies requires a multi-tiered analytical approach:

  • Baseline Expression Profiling: Establish baseline expression levels of PDZK1IP1 in blood transcriptomes of young healthy pigs (approximately 27 days of age). This provides a reference point before disease challenge .

  • Temporal Expression Analysis: Monitor PDZK1IP1 expression changes at multiple timepoints before and after pathogen exposure. Studies have demonstrated that blood transcriptomic profiles in young pigs can be predictive of their resilience to polymicrobial challenges later in life .

  • Multi-parameter Correlation: Analyze correlations between PDZK1IP1 expression and performance metrics such as growth rate, feed conversion rate, health scores, and mortality after disease challenge .

  • Network Analysis: Integrate PDZK1IP1 data into broader gene expression networks, particularly focusing on immune and stress response pathways that might be modulated by PDZK1IP1 function.

In a comprehensive study analyzing blood transcriptomes of 912 young healthy F1 barrows, genes related to immune and stress response (potentially including PDZK1IP1 and its interaction partners) showed significant associations with both pre- and post-challenge traits in a natural disease challenge model . Researchers should utilize similar large-scale approaches when investigating PDZK1IP1's role in disease resilience.

What are the current contradictions in the literature regarding pig PDZK1IP1 function and how should researchers address them?

Current literature reveals several contradictory findings regarding pig PDZK1IP1 function that researchers should address through careful experimental design:

  • Tissue-Specific Functions: While some studies suggest PDZK1IP1 primarily functions in epithelial tissues, recent data indicates significant expression and functional relevance in immune cells and blood transcriptomes . Researchers should include multiple tissue types in experimental designs to resolve this contradiction.

  • Pro-Inflammatory vs. Protective Roles: Contradictory data exists regarding whether PDZK1IP1 primarily promotes inflammation (through ROS generation and DNA damage) or contributes to cellular protection mechanisms. This contradiction can be addressed by employing both gain-of-function and loss-of-function approaches in the same experimental system.

  • Species-Specific Differences: Significant functional differences have been observed between human and pig PDZK1IP1, particularly in their interaction networks. Comparative studies using recombinant proteins from both species in identical experimental conditions can help resolve these contradictions.

  • Isoform-Specific Functions: The presence of multiple isoforms (X1, X2) of pig PDZK1IP1 suggests potential functional differences that have not been systematically investigated. Researchers should express and characterize each isoform separately to identify functional divergence.

To address these contradictions, researchers should implement controlled comparative studies with clearly defined experimental conditions, use multiple complementary methodologies, and employ appropriate statistical analyses to distinguish biological variability from true functional differences.

What are the optimal conditions for analyzing PDZK1IP1-protein interactions in porcine systems?

Analyzing PDZK1IP1-protein interactions in porcine systems requires optimization of several experimental parameters:

  • Buffer Composition: Interactions between PDZK1IP1 and its binding partners (such as COPS6, ZDHHC17, and UTP14A ) are sensitive to ionic strength. Optimal conditions include 25 mM Tris-HCl (pH 7.5), 100-150 mM NaCl, 0.1% NP-40, and 5% glycerol.

  • Temperature and Incubation Time: For co-immunoprecipitation studies, overnight incubation at 4°C shows higher specificity than shorter incubations at higher temperatures.

  • Crosslinking Consideration: Transient interactions may benefit from mild crosslinking (0.5-1% formaldehyde for 10 minutes at room temperature) prior to cell lysis.

  • Detection Methods: Proximity ligation assays (PLA) provide higher sensitivity than traditional co-IP for detecting PDZK1IP1 interactions in tissue contexts with lower expression levels.

  • Control Selection: Appropriate controls for specificity include:

    • IgG isotype controls for immunoprecipitation

    • Competition assays with recombinant binding partners

    • Interaction-deficient mutants where key binding domains are altered

These optimized conditions significantly improve detection sensitivity and specificity compared to standard protocols, reducing false positives that have contributed to contradictory findings in the literature.

How can researchers effectively utilize PDZK1IP1 as a biomarker in combination with pH2AX for translational research?

Effective utilization of PDZK1IP1 (MAP17) in combination with pH2AX as biomarkers requires standardized methodology for translational research:

  • Sample Processing Protocol: For tissue samples, immediate fixation in 10% neutral buffered formalin for 24 hours followed by paraffin embedding preserves both markers optimally. For blood or cell samples, immediate stabilization of proteins using phosphatase inhibitors is crucial for accurate pH2AX measurement.

  • Quantification Methods: Immunohistochemistry with digital image analysis using H-score methodology (combining intensity and percentage of positive cells) provides the most reliable quantification for tissue samples .

  • Reference Ranges: Establishing reference ranges for both markers is essential:

Tissue TypePDZK1IP1 Low ExpressionPDZK1IP1 High ExpressionpH2AX LowpH2AX High
Normal TissueH-score < 50H-score > 50< 10% positive nuclei> 10% positive nuclei
Tumor TissueH-score < 100H-score > 100< 30% positive nuclei> 30% positive nuclei
  • Clinical Correlation: Studies have shown that high levels of both pH2AX and MAP17 (PDZK1IP1) are related to clinical features and poor survival in certain cancers . This combination can potentially identify patients who might benefit from combined therapy with DNA-damaging agents (like doxorubicin) and PARP1 inhibitors (like olaparib) .

  • Validation Approach: Multi-center validation using tissue microarrays with diverse sample sets is recommended before clinical implementation of these biomarkers.

This standardized approach facilitates reproducible assessment of these biomarkers across different research settings and improves translational potential.

What are emerging applications of recombinant pig PDZK1IP1 in comparative oncology research?

Emerging applications of recombinant pig PDZK1IP1 in comparative oncology research represent a frontier area with significant potential:

  • Comparative Signaling Studies: Recombinant pig PDZK1IP1 provides valuable comparison models for understanding conserved and divergent oncogenic mechanisms between species. Recent data suggests that PDZK1IP1's role in ROS generation and DNA damage is conserved across species but with quantitative differences in potency .

  • Drug Response Prediction: The combination of PDZK1IP1 and pH2AX levels has emerged as a potential predictive biomarker for response to combined therapies targeting DNA damage repair pathways. Experiments in patient-derived xenografts have shown that tumors with high levels of both markers respond particularly well to doxorubicin and olaparib combination therapy .

  • Therapeutic Target Validation: Recombinant pig PDZK1IP1 can be used to develop and validate targeting strategies before translation to human applications. The protein's involvement in multiple interaction networks makes it a potential node for therapeutic intervention .

  • Functional Conservation Analysis: Systematic comparison of pig and human PDZK1IP1 functions in identical experimental systems can reveal evolutionarily conserved oncogenic mechanisms with relevance to both veterinary and human oncology.

These approaches leverage the unique advantages of porcine models for translational research while addressing fundamental questions about evolutionarily conserved mechanisms in cancer biology.

How should researchers design experiments to investigate PDZK1IP1's role in disease resilience in livestock?

Investigating PDZK1IP1's role in disease resilience requires a comprehensive experimental design that accounts for genetic, environmental, and pathogen variables:

  • Longitudinal Study Design: Monitor PDZK1IP1 expression in blood samples from young pigs (approximately 27 days of age) through development and after exposure to natural or experimental disease challenges . This approach allows for identification of expression patterns that predict future resilience.

  • Controlled Challenge Models: Utilize established challenge models such as the natural disease challenge model (NDCM) that exposes pigs to polymicrobial challenges, mimicking commercial conditions . This approach provides more translatable results than single-pathogen models.

  • Multi-Parameter Phenotyping: Collect comprehensive phenotypic data including:

    • Growth performance (average daily gain)

    • Feed efficiency (feed conversion ratio)

    • Clinical scores and treatments

    • Mortality rates

    • Tissue-specific responses

    • Immune parameters

  • Genetic Background Consideration: Include multiple genetic lines to distinguish PDZK1IP1 effects that are conserved across breeds versus those that are line-specific.

  • Network Analysis: Integrate PDZK1IP1 expression data with broader transcriptomic profiles, particularly focusing on identified biological processes associated with disease resilience, such as:

    • Immune and stress response pathways

    • Heme-related biological processes

    • Protein localization and viral gene expression mechanisms

This comprehensive approach allows for robust determination of PDZK1IP1's functional role in disease resilience while controlling for the complex variables inherent to livestock production environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.