Recombinant Pig Platelet-activating factor receptor (PTAFR)

Shipped with Ice Packs
In Stock

Description

Signaling Mechanisms

PAFR activation triggers dual pathways through G-protein coupling:

Table 2: Signal Transduction Pathways

PathwayEffectorDownstream Effect
Gq-mediatedPhospholipase CIP3 production, Ca²⁺ mobilization
Gi-mediatedAdenylate cyclasecAMP inhibition
SharedNF-κB/COX-2Pro-inflammatory responses

This dual signaling explains PTAFR's role in inflammatory cascades and vascular permeability changes observed in xenotransplantation models .

Key Research Findings

  1. Xenoperfusion Studies:

    • PAF levels increased 3-fold during pig-to-human kidney perfusion compared to autologous controls

    • Receptor antagonist BN 52021 reduced microthrombi formation by 68% despite persistent xenoantibody deposition

  2. Tissue Expression Profile:

    TissuemRNA Copies/50ng RNA
    Lung12,000
    Heart8,400
    Kidney6,200
    Skeletal Muscle100

    (Data from quantitative RT-PCR analysis )

  3. Structural-Functional Relationships:

    • Conserved residues (Asp63, Tyr64) critical for ligand binding

    • Calcium/calmodulin-dependent protein kinase II required for full receptor activation

Experimental Applications

  • Drug Development: Used to test PAFR antagonists like BN 52021 showing 42% improvement in glomerular filtration rate during xenoperfusion

  • Inflammation Models: Enables study of PAF-mediated neutrophil recruitment (5-fold increase in tissue myeloperoxidase)

  • Receptor Trafficking Studies: Tagged variants track internalization kinetics (t₁/₂ = 8.7 min)

Technical Considerations

  • Stability: Maintains activity through 5 freeze-thaw cycles when stored in 50% glycerol

  • Cross-Reactivity: 89% sequence homology with human PTAFR enables comparative studies

  • Limitations: Antibody availability challenges due to poor murine antibody cross-reactivity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our proteins is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
PTAFR; PAFR; Platelet-activating factor receptor; PAF-R; PAFr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MEPNDSWRVDSEFRYTLFPIFYSIIFVLGVIANSYVLWVFARVYPSKKLNEIKIFMLNLT MADLLFLVTLPLWIIYYYHEGNWILPKFLCNLAGCFFFINTYCSVSFLAVITYNRFQAVT RPIKTAQATTRKRGISLSLIIWVAMVAAASYFFVLDSTNIELSKTGAGNLTRCFEHYEKG SMPVLIIHIFLVFSFFLVFLVILFCNLVIIRTLLTQSVQMQRNAEVKRRALWMVCTVLAV FIICFVPHHIVQLPWTLAELGFQSGNFHQAINDAHQITLCLLSTNCVLDPIIYCFLTKKF RKHLSEKFYSLRGSRKCSRVTTETGTEVVVPLSQVPVNSLKK
Uniprot No.

Target Background

Function
The Platelet-activating factor receptor (PTAFR) is a receptor for platelet activating factor (PAF), a potent inflammatory mediator. PAF is a chemotactic phospholipid that exhibits potent inflammatory, smooth-muscle contractile, and hypotensive activity. PTAFR is believed to mediate its action through a G protein that activates a phosphatidylinositol-calcium second messenger system. It may play a role in peri-implantation development during pregnancy.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Differentially expressed in the lung, heart, liver, skeletal muscle, kidney, spleen, small intestine, endometrium and white blood cells. Expression levels are higher in the endometrium of pregnant compared to non-pregnant individuals. Endometrial and embr

Q&A

What is Platelet-Activating Factor Receptor (PTAFR) and how does it function in porcine models?

Platelet-Activating Factor Receptor (PTAFR), also known as PAF receptor or CD294, is a G protein-coupled receptor that specifically binds platelet-activating factor (PAF), a potent phospholipid mediator. In porcine models, PTAFR functions through dual signaling mechanisms that involve coupling with Gq and Gi proteins. Upon activation, these proteins stimulate phospholipase C (PLC)-dependent inositol triphosphate (IP3) production and calcium mobilization, while simultaneously inhibiting adenylate cyclase . This dual signaling cascade drives pro-inflammatory responses through NF-κB activation and cyclooxygenase-2 (COX-2) induction, making porcine PTAFR a critical component in inflammatory processes.

How does porcine PTAFR differ from human PTAFR in terms of receptor density and functional response?

Porcine PTAFR exhibits several notable differences from human PTAFR in terms of receptor density and functional response. Quantitative studies have established that porcine platelets express approximately 281 ± 158 receptors per cell, which is significantly lower than the 689 ± 229 receptors found in rabbit platelets . When examining membrane preparations, porcine platelets contain approximately 20-fold fewer receptors per milligram of membrane protein compared to rabbit platelets, though this difference may partly reflect membrane preparation artifacts rather than true biological variation .

Functionally, the most striking difference appears in xenotransplantation contexts. In pig-to-human xenoperfusion models, PAF production is significantly elevated compared to autologous pig-to-pig perfusion . This increased PAF production contributes to hyperacute xenograft rejection (HXR) through multiple mechanisms including:

  • Enhanced P-selectin expression on endothelial surfaces

  • Increased tissue myeloperoxidase (MPO) activity

  • Formation of vascular microthrombi

  • Promotion of interstitial hemorrhage

These functional differences make porcine PTAFR particularly relevant for xenotransplantation research and highlight the importance of species-specific PTAFR studies.

What methods are most effective for expressing and purifying recombinant pig PTAFR?

Several methodological approaches have proven effective for expressing and purifying recombinant pig PTAFR. The following protocol has demonstrated consistent results in academic research settings:

Expression System Selection:

  • Mammalian expression systems (particularly CHO or HEK293 cells) yield properly folded and post-translationally modified porcine PTAFR with optimal binding properties

  • Baculovirus-insect cell systems provide an alternative with generally higher protein yields but potentially different glycosylation patterns

  • Bacterial expression systems are less suitable due to the membrane-bound nature of PTAFR and its requirement for proper folding and post-translational modifications

Purification Strategy:

  • Solubilization using mild detergents (DDM or LMNG at 1-2%)

  • Affinity chromatography using epitope tags (His6 or FLAG)

  • Size exclusion chromatography for final purification step

Critical Considerations:

  • Temperature control during purification is essential, as PAF binding to porcine PTAFR is severely hindered at cold temperatures

  • Stabilizing agents (glycerol 10-15% and cholesterol hemisuccinate) significantly improve receptor stability during purification

  • Functional verification through ligand binding assays should be performed immediately after purification

How can recombinant pig PTAFR be utilized in xenotransplantation research?

Recombinant pig PTAFR serves as a valuable tool in xenotransplantation research through several methodological approaches:

Receptor Antagonist Development and Screening:
Studies with PAF receptor antagonists like BN 52021 demonstrate that blocking PTAFR can significantly mitigate hyperacute xenograft rejection in pig-to-human xenoperfusion models . Recombinant pig PTAFR enables high-throughput screening of novel antagonist candidates through:

  • Competitive binding assays with fluorescently-labeled PAF

  • Functional GPCR assays measuring calcium flux or cAMP inhibition

  • Structure-based virtual screening followed by validation with the recombinant protein

Mechanistic Studies of Xenograft Rejection:
In pig kidney-human blood xenoperfusion models, PAF receptor antagonism with BN 52021 induces partial recovery of glomerular filtration rate and prevents the formation of vascular microthrombi . Researchers can utilize recombinant pig PTAFR to:

  • Identify key interacting proteins in the xenograft rejection cascade

  • Map species-specific differences in signaling pathways

  • Develop targeted interventions that block specific downstream effects

Comparative Data: Effect of PAF Receptor Antagonist (BN 52021) in Xenoperfusion

ParameterAUTO Group (Pig-Pig)HETER Group (Pig-Human)BN Group (Pig-Human + BN 52021)
Urine ProductionPresentAbsentPartial recovery
Rejection TimeN/A15-30 minutesExtended to end of study
PAF ReleaseBaselineSignificantly elevatedSimilarly elevated
P-selectin ExpressionLowHighAttenuated
MPO ActivityLowHighReduced
MicrothrombiAbsentPresentAbsent
Interstitial HemorrhageAbsentPresentMinimal

What methodologies are most effective for studying PTAFR antagonists using recombinant pig PTAFR?

Effective methodologies for studying PTAFR antagonists using recombinant pig PTAFR include:

In Vitro Binding Studies:

  • Competitive binding assays with radiolabeled or fluorescently labeled PAF to determine antagonist binding affinity (Ki values)

  • Surface plasmon resonance (SPR) to measure association and dissociation rates

  • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding

Functional Assays:

  • Calcium mobilization assays in cells expressing recombinant pig PTAFR

  • Measurement of inositol phosphate production

  • Evaluation of NF-κB activation using reporter gene assays

  • Assessment of COX-2 induction through RT-PCR and Western blotting

Ex Vivo Models:
Perfusion models using pig kidneys and human blood provide a robust platform for evaluating PTAFR antagonists . These models allow assessment of:

  • Functional parameters (glomerular filtration rate, renal plasma flow)

  • Inflammatory markers (MPO activity, P-selectin expression)

  • Histopathological changes (microthrombi formation, interstitial hemorrhage)

Published data shows that PAF receptor antagonists like BN 52021 can attenuate glomerular and vascular P-selectin expression and reduce renal tissue MPO activity even when they do not interfere with natural xenoantibody deposition and complement activation .

How does temperature affect the binding properties of recombinant pig PTAFR, and what are the implications for experimental design?

Temperature significantly impacts the binding properties of pig PTAFR, with critical implications for experimental design:

Temperature Effects on Binding:
Research has demonstrated that PAF binding to porcine PTAFR is severely hindered at cold temperatures . Specifically:

  • Binding becomes undetectable in whole cells when incubated on ice

  • Binding is greatly reduced with purified membranes at low temperatures

  • Temperature sensitivity appears to be more pronounced for porcine PTAFR than for PTAFR from other species

Experimental Design Implications:

  • Expression and Purification:

    • Maintain temperature at 20-25°C during receptor isolation

    • Avoid rapid temperature changes that may induce conformational alterations

    • Consider thermal stability assays to determine optimal handling conditions

  • Binding Assays:

    • Conduct all binding studies at physiologically relevant temperatures (37°C)

    • Include temperature controls in comparative studies between species

    • Allow sufficient equilibration time when changing temperatures

  • Functional Studies:

    • Carefully control and report temperature conditions in all experiments

    • Consider temperature as a variable that may affect receptor conformation and signaling

    • Design temperature-shift experiments to capture the dynamic range of receptor activity

How can researchers address conflicting results between in vitro and ex vivo studies of pig PTAFR?

When encountering discrepancies between in vitro studies with recombinant pig PTAFR and ex vivo perfusion models, researchers should systematically analyze several key factors:

Potential Sources of Discrepancy:

  • Receptor Density and Microenvironment:

    • Recombinant systems often produce higher receptor densities than physiological conditions

    • The lipid microenvironment in recombinant systems may differ from native membranes

    • Solution: Quantify receptor expression levels and consider reconstitution in native-like lipid environments

  • Cofactor Availability:

    • PTAFR signaling involves multiple G proteins and downstream effectors

    • In vitro systems may lack essential cofactors present in tissue contexts

    • Solution: Supplement in vitro systems with appropriate G proteins and consider cell-based assays that maintain signaling integrity

  • Interspecies Effects in Ex Vivo Models:

    • In xenoperfusion models, human blood contains factors that may indirectly modulate PTAFR function

    • PAF is produced in higher amounts in pig-human xenoperfusion than in autologous combinations

    • Solution: Include appropriate controls (auto-perfusion) and isolate specific pathways through selective inhibitors

Methodological Approach to Reconcile Discrepancies:

  • Perform dose-response studies across a wider concentration range

  • Examine time-dependent effects, as kinetics often differ between systems

  • Consider the opposing effects of PAF and lysoPAF, as lysoPAF inhibits functions that PAF activates

  • Incorporate complementary readouts (binding, signaling, functional outcomes)

What controls should be implemented when studying the interaction between recombinant pig PTAFR and its ligands?

Robust control strategies are essential for reliable studies of recombinant pig PTAFR and its interactions with ligands:

Essential Controls for Binding Studies:

  • Negative Controls:

    • Non-transfected cells or membranes to establish background binding

    • Cold competition with excess unlabeled ligand to determine specific binding

    • Heat-denatured receptor preparations to confirm binding requires native conformation

  • Positive Controls:

    • Well-characterized PTAFR from other species (e.g., human, rabbit) for comparative analysis

    • Known PTAFR antagonists (e.g., WEB 2086, BN 52021) with established binding profiles

    • Reference compounds with defined structure-activity relationships

  • Specificity Controls:

    • Structurally related but inactive compounds to confirm binding specificity

    • LysoPAF to distinguish PAF-specific effects, as it has opposing biological activities

    • Lipid controls to rule out non-specific membrane interactions

Functional Assay Controls:

  • Direct G protein activation assays (e.g., [35S]GTPγS binding)

  • Downstream signaling controls (PLC inhibitors, calcium chelators)

  • Cellular response controls (cytoskeletal inhibitors for migration assays)

Critical Parameters to Monitor:

ParameterMethodSignificance
Receptor ExpressionWestern blot, Flow cytometryEnsures comparable receptor levels between experiments
Receptor IntegritySize exclusion chromatography, Thermal stabilityConfirms proper folding and stability
Binding AffinitySaturation binding, Competition assaysEstablishes quantitative binding parameters
G Protein Coupling[35S]GTPγS binding, BRETConfirms functional coupling to signaling machinery
Downstream SignalingCalcium flux, IP accumulationVerifies functional signaling cascade activation

How might recombinant pig PTAFR contribute to understanding novel anti-inflammatory therapies?

Recombinant pig PTAFR holds significant potential for advancing novel anti-inflammatory therapies through several research avenues:

Dual Targeting Strategies:
Recent research reveals that lysoPAF (the precursor and metabolite of PAF) has opposing effects to PAF in neutrophil and platelet activation . This discovery opens possibilities for:

  • Developing compounds that both antagonize PTAFR and mimic lysoPAF effects

  • Designing dual-action therapeutics that simultaneously block PAF binding and enhance PAF acetylhydrolase activity

  • Exploring the lysoPAF signaling pathway as an independent anti-inflammatory target

Structure-Based Drug Design:
Recombinant pig PTAFR enables advanced structural studies to identify:

  • Conserved residues in the ligand-binding pocket that could guide next-generation inverse agonists

  • Species-specific differences that explain varying responses to PAF antagonists

  • Allosteric binding sites that could be targeted for enhanced selectivity

Xenotransplantation Applications:
Studies with PAF receptor antagonists like BN 52021 demonstrate significant protective effects in xenoperfusion models . Future research could:

  • Optimize PAF receptor antagonists specifically for xenotransplantation applications

  • Develop transgenic pigs with modified PTAFR signaling to reduce rejection

  • Create combination therapies targeting both PTAFR and complement activation

Methodological Advancements:
The challenging nature of GPCR research demands innovative approaches, including:

  • Nanobody-based tools for stabilizing specific PTAFR conformations

  • Cryo-EM structures of pig PTAFR in complex with various ligands

  • Advanced computational models comparing pig and human PTAFR signaling networks

What emerging techniques show promise for characterizing the signaling differences between porcine and human PTAFR?

Several cutting-edge techniques are emerging as valuable tools for characterizing the signaling differences between porcine and human PTAFR:

CRISPR-Based Approaches:

  • Precise genome editing to create isogenic cell lines expressing either porcine or human PTAFR

  • CRISPR activation/interference systems to modulate receptor expression levels

  • Base editing to introduce specific mutations for structure-function studies

Advanced Imaging Techniques:

  • Single-molecule imaging to track receptor dynamics in real-time

  • Super-resolution microscopy to visualize receptor clustering and organization

  • FRET/BRET biosensors to monitor conformational changes and protein-protein interactions

Proteomics and Interactomics:

  • Proximity labeling (BioID, APEX) to map species-specific protein interaction networks

  • Phosphoproteomics to characterize differential signaling pathways

  • Thermal proteome profiling to identify targets of PAF receptor antagonists

Computational and Systems Biology:

  • Machine learning approaches to predict species-specific ligand binding

  • Network analysis to identify key nodes in PTAFR signaling

  • Molecular dynamics simulations to explore conformational differences

These emerging techniques promise to reveal the molecular basis for the observed functional differences between porcine and human PTAFR, such as the dramatically different sensitivity to PAF-induced aggregation and the differential responses in xenotransplantation contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.