Recombinant Pig PRA1 family protein 3 (ARL6IP5)

Shipped with Ice Packs
In Stock

Description

Glutamate Transport Regulation

ARL6IP5 interacts with the glutamate transporter SLC1A1 (EAAC1) to modulate its activity. In pigs and other mammals, this interaction reduces glutamate uptake efficiency in a PKC-dependent manner, influencing synaptic neurotransmission and cellular stress responses .

Cytoskeletal Association

The protein’s association with cytoskeletal elements implies roles in cell differentiation, particularly in dermal papillae and neuronal systems . Retinoic acid upregulates ARL6IP5 expression in rats, linking it to vitamin A-dependent signaling .

Applications in Biomedical Research

Recombinant Pig ARL6IP5 is utilized in:

ApplicationMethodPurpose
ELISASandwich immunoassay Quantify endogenous ARL6IP5 in tissue samples
SDS-PAGE/Western BlotHis/GST-tag detection Validate expression or purification efficiency
ProteomicsiTRAQ LC–MS/MS Identify interaction partners in viral models
Cell CultureTransfection with siRNA Study functional knockdown effects

Research Challenges and Future Directions

While recombinant Pig ARL6IP5 is valuable for studying glutamate transport and neuroprotection, gaps remain:

  1. Mechanistic Insights: Direct evidence of its role in porcine neurodegenerative diseases is lacking.

  2. Therapeutic Potential: Potential as a biomarker or drug target for neurological disorders requires validation.

  3. Viral Interactions: Proteomic studies in PRRSV-infected cells highlight its role in stress response pathways , warranting further investigation in swine health.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us; we will prioritize its inclusion.
Synonyms
ARL6IP5; PRAF3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
ARL6IP5
Target Protein Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDILRRLKKQYPTVFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKIEGIGLKRTPMGIVLDALEQQEENISKFA DYISKVNE
Uniprot No.

Target Background

Function

This protein regulates intracellular taurine and glutamate concentrations. It negatively modulates SLC1A1/EAAC1 glutamate transport activity by reducing its glutamate affinity in a PKC activity-dependent manner. Furthermore, it plays a role in retaining SLC1A1/EAAC1 within the endoplasmic reticulum.

Database Links
Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.

Q&A

What is PRA1 family protein 3 (ARL6IP5) and what are its known functions?

ARL6IP5, also known as PRA1 family protein 3, is a protein encoded by the ARL6IP5 gene that plays multiple roles in cellular processes. The protein is associated with the cytoskeleton and may play a role in regulating cell differentiation . Studies have shown that ARL6IP5 functions as an autophagy inducer, which is particularly significant in neurodegenerative contexts . The protein has also been implicated in binding and inhibiting the cell membrane glutamate transporter EAAC1 . Expression of this gene is affected by vitamin A, with retinoic acid upregulating its expression, which subsequently results in specific reduction in EAAC1-mediated glutamate transport . In mouse models, disruption of the ARL6IP5 gene results in increased neuronal glutathione content, neuroprotection against oxidative stress, and improved performance in motor/spatial learning and memory tests compared to wild-type mice .

How does recombinant pig ARL6IP5 differ from human and mouse orthologs?

Recombinant pig ARL6IP5 (also identified by the gene name PRAF3) shares significant homology with human and mouse orthologs, though species-specific variations exist that may affect protein function and interactions . The human ARL6IP5 is known by multiple aliases including DERP11, JWA, PRA2, PRAF3, HSPC127, and others . The mouse ortholog is identified as Arl6ip5, Aip5, Jwa, Pra2, Praf3, and additional aliases including Gtrap3-18 . While the basic function of mediating autophagy and neuroprotection appears conserved across species, differences in amino acid sequences may result in species-specific binding affinities and interaction partners. Researchers should consider these potential differences when using pig ARL6IP5 as a model for human applications, particularly when studying species-specific membrane interactions or protein-protein binding domains.

What expression systems are commonly used for recombinant pig ARL6IP5 production?

Recombinant pig ARL6IP5 is predominantly produced using cell-free expression systems to ensure proper protein folding and post-translational modifications . These systems offer advantages including reduced contamination risk and the ability to produce proteins that might be toxic to host cells. For human ARL6IP5, E. coli expression systems have been successfully employed , suggesting this might also be viable for pig variants under appropriate conditions. The expression system choice significantly impacts protein quality, yield, and functionality. Cell-free expression systems generally provide greater than or equal to 85% purity as determined by SDS-PAGE for pig ARL6IP5 . For applications requiring higher purity or specific modifications, researchers may need to consider mammalian cell expression systems, although these typically result in lower yields compared to bacterial or cell-free systems.

How can recombinant pig ARL6IP5 be utilized in Parkinson's disease models?

Based on studies with human ARL6IP5, recombinant pig ARL6IP5 holds significant potential for Parkinson's disease (PD) research models. Research has demonstrated that ARL6IP5 levels decrease in the brain with age and in PD in both mice and humans . When overexpressed, ARL6IP5 reduces α-synuclein aggregate burden and improves cell survival in A53T models of Parkinson's disease . The neuroprotective mechanism appears to function through autophagy induction, as ARL6IP5 has been identified as a novel regulator of neuronal autophagy .

For experimental applications, researchers could utilize recombinant pig ARL6IP5 to study cross-species conservation of this neuroprotective mechanism. Experimental designs might include:

  • Comparative studies between human and pig ARL6IP5 in α-synuclein clearance efficiency

  • Evaluation of pig ARL6IP5's ability to induce autophagy in neuronal cell lines

  • Assessment of whether pig ARL6IP5 demonstrates similar reductions in α-synuclein fluorescence (28 ± 33 in ARL6IP5 transfected cells compared to 58 ± 24 in control cells, p < 0.0001) as observed with human variants

What experimental approaches can be used to study ARL6IP5's role in autophagy modulation?

To investigate ARL6IP5's role in autophagy modulation, researchers can employ multiple complementary approaches:

  • Autophagy marker analysis: Measure levels of autophagy markers like LC3-II/LC3-I ratio and p62/SQSTM1 in response to recombinant pig ARL6IP5 treatment or overexpression. Research has shown that ARL6IP5 overexpression upregulates autophagy markers (177 ± 45%, p = 0.0005, n = 3 compared to control), and this upregulation persists (155 ± 46%, p = 0.048, n = 3) when ARL6IP5 and α-synuclein are co-expressed .

  • Autophagy flux assessment: Use tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to distinguish between autophagosome formation and maturation phases.

  • Kinase activity measurement: Analyze the phosphorylation status of autophagy-related kinases. Studies have shown that ARL6IP5 can restore phosphorylation levels of kinases altered by α-synuclein overexpression .

  • Genetic approaches: Compare autophagy induction between wild-type and ARL6IP5 knockout models, or employ siRNA-mediated knockdown combined with autophagy inducers or inhibitors.

  • Electron microscopy: Visualize autophagosome and autolysosome formation in cells expressing recombinant pig ARL6IP5.

How does ARL6IP5 interact with the glutamate transporter system across species?

ARL6IP5 has demonstrated interactions with the glutamate transporter system, particularly with SLC1A1 (also known as EAAC1) . The rat ortholog of ARL6IP5 binds and inhibits EAAC1, with its expression being upregulated by retinoic acid, resulting in specific reduction of EAAC1-mediated glutamate transport . This interaction appears to be conserved across species, though binding affinities and regulatory mechanisms may vary.

For studying these interactions using pig ARL6IP5, researchers should consider:

  • Co-immunoprecipitation assays: To verify direct binding between pig ARL6IP5 and glutamate transporters

  • Glutamate uptake assays: To assess functional consequences of ARL6IP5-transporter interactions

  • Site-directed mutagenesis: To identify critical binding domains in the pig variant compared to other species

  • Cross-species comparative analyses: To determine if the pig variant exhibits similar regulatory effects on glutamate transport as observed in rat and human models

Understanding these interactions is particularly relevant for neurodegenerative disease research, as glutamate excitotoxicity plays a significant role in neuronal death mechanisms.

What are the optimal storage and handling conditions for recombinant pig ARL6IP5?

Based on protocols for human ARL6IP5, recombinant pig ARL6IP5 likely requires careful handling to maintain stability and activity. The following guidelines are recommended:

  • Storage: Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles that can compromise protein integrity .

  • Reconstitution: Briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-term storage: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. A final concentration of 50% glycerol is typical .

  • Working aliquots: Store working aliquots at 4°C for up to one week to minimize degradation .

  • Buffer considerations: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been successfully used for human ARL6IP5 and may be suitable for the pig variant as well.

These handling procedures help maintain protein stability and activity for experimental applications.

What experimental controls are essential when studying ARL6IP5 in neurodegenerative disease models?

When designing experiments to study pig ARL6IP5 in neurodegenerative disease models, several controls are critical for valid scientific interpretation:

  • Negative controls:

    • Empty vector transfections to control for vector effects

    • Inactive/mutant ARL6IP5 to control for protein-specific effects

    • Age-matched wild-type samples when working with disease models

    • Scrambled siRNA when performing knockdown studies

  • Positive controls:

    • Known autophagy inducers (e.g., rapamycin) when studying autophagy mechanisms

    • Human ARL6IP5 for cross-species comparative studies

  • Experimental validation controls:

    • Verification of successful transfection/expression

    • Confirmation of protein levels via western blot

    • Assessment of cell viability to ensure observed effects aren't due to toxicity

  • Time-course controls:

    • Age-dependent studies as ARL6IP5 levels are known to decline with age (44 ± 17%, p = 0.0015, n = 3 reduction at 12 months compared to 4 months)

    • Time-dependent sampling to capture transient effects on autophagy flux

  • Disease model verification:

    • Confirmation of disease phenotype (e.g., α-synuclein aggregation) before intervention with ARL6IP5

What methods are recommended for assessing ARL6IP5's impact on neuronal survival and function?

To comprehensively evaluate pig ARL6IP5's impact on neuronal survival and function, multiple complementary approaches are recommended:

  • Cell viability assays:

    • LDH assay (which has been used to confirm toxicity in ARL6IP5 knockdown conditions, showing 15 ± 7% increased toxicity, p = 0.018, n = 6)

    • MTT/MTS assays for metabolic activity

    • Annexin V/PI staining for apoptosis quantification

  • Functional assessments:

    • Calcium imaging to evaluate neuronal activity

    • Electrophysiological recordings to assess synaptic transmission

    • Neurite outgrowth measurement for morphological analysis

  • Oxidative stress parameters:

    • ROS measurement, particularly relevant as ARL6IP5 gene disruption in mice results in neuroprotection against oxidative stress

    • Glutathione content quantification

    • Lipid peroxidation assays

  • Protein aggregation evaluation:

    • Quantification of α-synuclein aggregates via immunofluorescence

    • Filter trap assays for insoluble protein aggregates

    • Native gel electrophoresis for oligomeric species detection

  • Autophagy assessment:

    • LC3 puncta formation

    • Autophagic flux measurement with bafilomycin A1

    • Electron microscopy for ultrastructural analysis

How do the neuroprotective effects of ARL6IP5 compare across different species models?

The neuroprotective effects of ARL6IP5 appear to be conserved across species, though with potential variations in potency and mechanism. In mouse models, disruption of the ARL6IP5 gene results in increased neuronal glutathione content, neuroprotection against oxidative stress, and improved performance in motor/spatial learning and memory tests compared to wild-type mice . Human studies have shown decreased ARL6IP5 levels in Parkinson's disease patients, and in vitro studies demonstrated that human ARL6IP5 overexpression reduces α-synuclein aggregate burden and improves cell survival in A53T models .

For comparative analysis between pig ARL6IP5 and other species variants, researchers should consider:

  • Cross-species rescue experiments: Testing if pig ARL6IP5 can rescue deficits in human or mouse cell models

  • Structural comparisons: Analyzing protein domains and post-translational modifications that might differ between species

  • Binding affinity studies: Examining if pig ARL6IP5 exhibits different affinities for interaction partners like glutamate transporters or autophagy machinery

  • Therapeutic potential evaluation: Assessing if species variations affect therapeutic applications in neurodegenerative disease models

Such comparative studies would provide valuable insights into conserved functional domains and species-specific therapeutic applications.

What experimental approaches can detect differences in ARL6IP5 interaction with autophagy machinery between species?

To detect potential species-specific differences in how pig ARL6IP5 interacts with autophagy machinery compared to human or mouse variants, several experimental approaches are recommended:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interaction partners

    • Proximity ligation assays to visualize interactions in situ

    • FRET/BRET analysis for real-time interaction dynamics

    • Yeast two-hybrid screening to identify novel binding partners

  • Functional autophagy assays:

    • Comparative LC3-II/LC3-I ratio measurement following expression of different species' ARL6IP5

    • Autophagic flux analysis using tandem fluorescent-tagged LC3

    • p62/SQSTM1 degradation rates across species variants

  • Phosphorylation analysis:

    • Phosphoproteomic analysis to compare kinase activation patterns

    • Western blotting for phosphorylated autophagy proteins (human ARL6IP5 has been shown to affect phosphorylation of autophagy-related kinases)

  • Structural biology approaches:

    • Crystallography or cryo-EM to identify structural differences between species variants

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Domain mapping and mutagenesis:

    • Chimeric constructs between species to identify critical functional domains

    • Site-directed mutagenesis at non-conserved residues to test functional significance

What emerging applications exist for recombinant pig ARL6IP5 in translational medicine?

Recombinant pig ARL6IP5 presents several promising translational applications based on its functional properties and the established role of human ARL6IP5 in neuroprotection:

  • Neurodegenerative disease therapies: Given ARL6IP5's capacity to reduce α-synuclein aggregation and improve neuronal survival , pig variants could serve as alternative therapeutic agents for conditions like Parkinson's disease.

  • Biomarker development: As ARL6IP5 levels decline with age and in neurodegenerative conditions (71 ± 14%, p = 0.0002, n = 3 decrease compared to wild-type) , pig models could help develop early diagnostic biomarkers.

  • Drug screening platforms: Recombinant pig ARL6IP5 could be incorporated into high-throughput screening systems to identify compounds that enhance its autophagy-inducing properties.

  • Gene therapy vectors: Optimized pig ARL6IP5 sequences might offer advantages in gene therapy approaches, particularly if they demonstrate enhanced stability or activity compared to human variants.

  • Xenotransplantation research: As pig models are increasingly important in organ transplantation research, understanding ARL6IP5's role in neuroprotection could inform strategies to protect neural tissue in xenotransplantation contexts.

These applications warrant further investigation, particularly comparative studies between human and pig ARL6IP5 to identify any species-specific advantages for therapeutic development.

How might genetic engineering of ARL6IP5 enhance its therapeutic potential?

Strategic genetic engineering of ARL6IP5 could significantly enhance its therapeutic potential for neurodegenerative diseases:

  • Enhanced autophagy induction: Targeted modifications to autophagy-inducing domains could amplify ARL6IP5's capacity to clear protein aggregates.

  • Improved stability: Engineering protease-resistant variants or extended half-life through strategic amino acid substitutions could prolong therapeutic effects.

  • Cell-specific targeting: Fusion with cell-specific targeting peptides could direct therapeutic effects to neurons or glial cells most affected in particular diseases.

  • Controlled activation: Development of conditionally active variants that respond to disease-specific triggers could minimize off-target effects.

  • Combinatorial approaches: Engineering bifunctional ARL6IP5 variants that simultaneously enhance autophagy and reduce oxidative stress could provide synergistic neuroprotection.

  • Species-optimized variants: Creating chimeric proteins incorporating advantageous features from pig, human, and mouse ARL6IP5 could optimize therapeutic efficacy.

Such engineering approaches require detailed understanding of ARL6IP5's structure-function relationships and would benefit from cross-species comparative studies to identify optimal configurations for specific therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.