Recombinant Pig Protein Asterix (WDR83OS)

Shipped with Ice Packs
In Stock

Description

Physical Properties

Table 1: Physical Properties of Recombinant Pig Protein Asterix (WDR83OS)

PropertySpecification
SpeciesSus scrofa (Pig)
SourceE. coli
TagHis
Protein LengthFull Length (1-106)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C, avoid repeated freeze-thaw cycles

The recombinant protein is typically provided in lyophilized form and requires reconstitution prior to experimental use. Manufacturers recommend reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

Functional Roles and Biological Significance

Asterix/GTSF1 (Gametocyte-specific factor 1) represents a family of proteins highly conserved across species from insects to humans. Research has established its critical role in several biological processes, with particularly important functions in germline development and genetic stability.

Role in RNA Interference Pathways

One of the primary functions of Asterix/GTSF1 involves its participation in the Piwi-interacting RNA (piRNA) pathway . This pathway is crucial for maintaining genomic integrity by silencing transposable elements (transposons) in the germline. Studies using enhanced crosslinking and immunoprecipitation (eCLIP) with custom informatic pipelines have demonstrated that Asterix/GTSF1 specifically binds tRNAs in cellular contexts .

The protein's structure, determined by NMR spectroscopy, reveals that the RNA-binding interface is located on the protein's first zinc finger. This finding has been corroborated by biochemical analysis and cryo-EM structures of GTSF1 in complex with co-purifying tRNA . Consistent with the dependence of long terminal repeat (LTR) retrotransposons on tRNA primers, research shows that LTR retrotransposons are preferentially de-repressed in Asterix mutants .

Gametogenesis and Development

Asterix/GTSF1 serves as an essential gametogenesis factor conserved across animal species . During metazoan gametogenesis, extensive epigenetic reprogramming occurs in the germline, allowing for the transmission of both genetic and epigenetic information. This process is critical for zygotic totipotency required for offspring development .

The protein contributes to the repression of potentially deleterious transposons, helping to ensure faithful transmission of genetic information to the next generation. This function is particularly important during the dramatic transcriptional reset that occurs during gametogenesis, when genes that had been silenced through heterochromatic compaction or DNA methylation can reactivate .

Recombinant Production and Characterization

The production of Recombinant Pig Protein Asterix (WDR83OS) typically involves expressing the protein in bacterial expression systems, most commonly E. coli. This approach allows for the generation of significant quantities of the protein for research applications.

Expression Systems and Purification

The recombinant protein is expressed with an N-terminal His tag to facilitate purification using affinity chromatography methods . The His tag enables selective binding to metal chelate resins, allowing for efficient isolation of the target protein from bacterial lysates. Following purification, the protein typically undergoes quality control assessments, including SDS-PAGE analysis to confirm purity and molecular weight.

Comparative Analysis with Other Species

WDR83OS is conserved across numerous species, with homologs identified in humans, rats, sheep, naked mole-rats, cows, domestic guinea pigs, and domestic cats . This high degree of conservation suggests fundamental biological importance and provides opportunities for comparative studies.

Table 2: Interspecies Gene ID Comparison for WDR83OS

SpeciesGene ID
Human51398
Rat288925
Sheep101107958
Naked mole-rat101709033
Cow508733
Domestic guinea pig100717923
Domestic cat101083404
PigQ6Q7K0 (UniProt)

Research Applications and Experimental Protocols

Recombinant Pig Protein Asterix (WDR83OS) has numerous applications in biological research, particularly in studies focused on RNA processing, transposon silencing, and germline development.

Applications in CRISPR/Cas9 Genome Editing

Recent advances in gene editing technologies have expanded the potential applications of recombinant proteins in pig models. The CRISPR/Cas9 system has been successfully employed for generating gene-targeted pigs without selection marker genes . While not specifically targeting WDR83OS, these techniques demonstrate the potential for utilizing recombinant proteins in conjunction with genome editing to investigate gene function in pig models.

Efficient transfection of porcine fetal fibroblasts (PFFs) has been achieved to facilitate Cas9/gRNA targeting, enabling non-homologous end-joining (NHEJ), long fragment deletions/inversions, and homology-directed repair (HDR) at specific gene loci . These approaches could potentially be applied to study WDR83OS function in pig models.

Relationship to Transposon Silencing Mechanisms

One of the most significant aspects of Asterix/GTSF1 function is its role in transposon silencing. Transposons are mobile genetic elements that can insert into distant genetic loci and potentially disrupt coding or regulatory regions. The silencing of these elements is crucial for maintaining genomic integrity.

tRNA Binding and LTR Retrotransposon Silencing

Research has established a mechanistic link between Asterix/GTSF1, tRNAs, and LTR retrotransposon silencing . The protein appears to exploit the tRNA dependence of retrotransposons to identify transposon transcripts and promote piRNA silencing. This function is particularly important during gametogenesis when extensive epigenetic reprogramming can lead to the reactivation of transposons .

Implications for Germline Genomic Integrity

The maintenance of germline genomic integrity is critical for species survival. Multiple cellular and molecular processes have evolved to ensure genetic stability during gamete production. Asterix/GTSF1 contributes to this stability by participating in the piRNA-RNA interference pathway, helping to ensure faithful transmission of genetic information to subsequent generations .

Current Research and Future Directions

Current research on Recombinant Pig Protein Asterix (WDR83OS) continues to expand our understanding of its structure, function, and potential applications. Advanced techniques such as single-cell RNA sequencing are being applied to characterize cell types in porcine tissues, potentially offering new insights into WDR83OS expression patterns .

Integration with Other Molecular Pathways

Understanding how WDR83OS integrates with other molecular pathways remains an active area of research. The protein has been shown to interact with the PAT (protein associated with the ER translocon) complex, as indicated by its alternative name "PAT complex subunit Asterix" . Further research is needed to fully characterize these interactions and their functional significance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
WDR83OS; PAT complex subunit Asterix; Protein WDR83OS homolog; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
WDR83OS
Target Protein Sequence
MSANSMSDPRSPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVA VYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW
Uniprot No.

Target Background

Function
Asterix (WDR83OS) is a component of the PAT complex, an endoplasmic reticulum (ER)-resident membrane protein complex that facilitates the insertion of multi-pass membrane proteins into the ER membrane. Functioning as an intramembrane chaperone, the PAT complex interacts directly with nascent transmembrane domains (TMDs). It releases its substrates upon correct folding and is essential for optimal biogenesis of multi-pass membrane proteins. WDR83OS/Asterix, the substrate-interacting subunit, associates with the first TMD (TMD1) of the nascent polypeptide chain, independently of N-glycosylation and irrespective of the amino acid sequence or topology of TMD1. The PAT complex preferentially binds to TMDs with exposed hydrophilic amino acids within the lipid bilayer, providing a partially hydrophilic membrane environment for TMD1 binding. CCDC47 is required for maintaining the stability of WDR83OS/Asterix.
Database Links
Protein Families
Asterix family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Pig Protein Asterix (WDR83OS) and what cellular functions does it perform?

Asterix, encoded by the WDR83OS gene, is a 106-amino acid protein that functions as part of the PAT (protein associated with ER translocon) complex by heterodimerizing with CCDC47. This complex serves as a chaperone for large proteins containing transmembrane domains (TMDs), ensuring proper folding during membrane insertion .

The protein contains three transmembrane domains with the N-terminus facing the cytosol and C-terminus oriented toward the ER lumen. These TMDs are unusually short (approximately 15 amino acids each) and contain numerous hydrophilic residues and multiple cysteines that facilitate interaction with client proteins .

Methodology for functional analysis typically involves crosslinking experiments combined with mass spectrometry to identify interaction partners and characterize the chaperone activity in various cellular contexts.

How should recombinant WDR83OS protein be handled for optimal experimental results?

For optimal experimental results with recombinant WDR83OS, follow these methodological guidelines:

  • Storage: Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles which can compromise protein integrity .

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Typical storage buffer consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Quality control: Verify protein purity (>90% as determined by SDS-PAGE) and functional integrity through binding assays or structural studies before experimental use .

What experimental evidence supports Asterix's role in membrane protein biogenesis?

Multiple experimental approaches have established Asterix's role in membrane protein biogenesis:

  • Crosslinking studies: Site-specific photo-crosslinking experiments have shown that Asterix directly engages TMDs that expose hydrophilic residues within the lipid bilayer, in a position-independent manner .

  • Substrate preference analysis: Replacement of polar amino acids in TMDs with leucine markedly reduces Asterix-TMD interaction, while reintroduction of polar or charged residues partially restores this interaction, demonstrating specificity for TMDs with exposed hydrophilic residues .

  • Native immunoprecipitation: Analysis via CCDC47 native IPs confirms that Asterix can crosslink with TMDs of either orientation and different unrelated sequences .

  • Loss-of-function studies: Depletion of PAT complex components leads to impaired membrane protein biogenesis, indicating their requirement for optimal folding of multi-spanning membrane proteins .

How does the molecular mechanism of WDR83OS/Asterix differ from other membrane protein chaperones?

The molecular mechanism of WDR83OS/Asterix represents a distinct chaperoning strategy compared to other membrane protein chaperones:

  • Substrate recognition specificity: Unlike many chaperones that recognize hydrophobic patches, Asterix preferentially engages TMDs with exposed hydrophilic residues within the lipid bilayer. This is analogous to how soluble chaperones prefer hydrophobic patches exposed to the aqueous environment, but with an inverted recognition paradigm .

  • Substrate release mechanism: The PAT complex appears to be displaced by the more favorable TMD-TMD interactions that accompany correct folding. This substrate-driven displacement mechanism differs from ATP-dependent release mechanisms seen in many other chaperone systems .

  • Intramembrane chaperoning: The PAT complex functions as an intramembrane chaperone, directly interacting with TMDs within the lipid bilayer. This distinguishes it from cytosolic or lumenal chaperones that typically engage extramembrane domains .

Methodologically, comparative analysis between WDR83OS and other chaperones requires techniques like hydrogen-deuterium exchange mass spectrometry, site-directed mutagenesis, and in vitro reconstitution with purified components to map binding interfaces and functional domains.

What is the relationship between WDR83OS mutations and neurodevelopmental disorders?

Research has established significant connections between WDR83OS mutations and neurodevelopmental disorders:

  • Clinical phenotype: Biallelic variants in WDR83OS, particularly homozygous truncating variants, are associated with neurodevelopmental disorders characterized by facial dysmorphism (13/14 patients), intractable itching (9/14), and elevated bile acids (5/6 tested), with normal to mildly elevated liver enzymes .

  • Developmental trajectory: In some affected individuals, a progressive reduction in relative head circumference has been observed over time, suggesting ongoing developmental impact .

  • Animal model evidence: A zebrafish model lacking Wdr83os function supports its crucial role in the nervous system, craniofacial development, and lipid absorption, recapitulating key aspects of the human phenotype .

  • Molecular mechanism: The disease mechanism appears to involve biallelic loss-of-function of WDR83OS leading to neurological disease with hypercholanemia. This mechanism is conceptually similar to that described for biallelic CCDC47 variants, which cause trichohepatoneurodevelopmental syndrome .

Methodologically, researchers investigating this relationship typically employ family-based rare variant analyses of exome sequencing data, case matching through platforms like GeneMatcher, and functional validation in animal models.

What techniques are most effective for studying WDR83OS interactions with other components of the PAT complex?

To effectively study WDR83OS interactions with other PAT complex components, particularly CCDC47, researchers can employ these advanced methodological approaches:

  • Crosslinking-mass spectrometry (XL-MS): This approach can capture transient interactions and map precise contact sites between Asterix and its binding partners.

  • Proximity labeling: BioID or APEX2 fused to WDR83OS can identify proteins in close proximity under native cellular conditions.

  • Reconstitution systems: Purified components can be reconstituted in liposomes or nanodiscs to study interactions in a controlled membrane environment.

  • Co-immunoprecipitation under non-denaturing conditions: This approach has successfully identified six proteins enriched more than 2-fold relative to controls, including Sec61α and Sec61β, the lectins Calnexin and Galectin-7, signal peptide peptidase (SPP), and CCDC47 .

  • Site-specific photo-crosslinking: This technique has been optimized to map interactions between Asterix and transmembrane domains at specific sites and can reveal dynamic changes in these interactions .

How can researchers optimize expression and purification of functional recombinant WDR83OS?

Optimizing expression and purification of functional recombinant WDR83OS requires addressing several technical challenges:

  • Expression system selection:

    • Prokaryotic systems (E. coli) have been successfully used to express full-length pig Asterix protein with N-terminal His tags

    • For functional studies, mammalian or insect cell expression systems may better preserve native folding and post-translational modifications

  • Purification strategy:

    • Metal affinity chromatography using His-tags has proven effective for initial purification

    • Consider size exclusion chromatography as a second purification step to ensure removal of aggregates

    • When using denaturing conditions, implement controlled refolding through dialysis against decreasing concentrations of denaturant

  • Protein folding verification:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Tryptophan fluorescence to monitor tertiary structure

    • Functional binding assays to confirm biological activity

  • Stability optimization:

    • Addition of 6% trehalose to storage buffer enhances stability

    • Aliquoting and storing at -80°C prevents repeated freeze-thaw cycles

    • Consider addition of mild detergents for membrane protein stability

What experimental approaches can identify the complete spectrum of WDR83OS client proteins?

To comprehensively identify WDR83OS client proteins, researchers should implement a multi-faceted experimental strategy:

  • Proximity-dependent biotinylation:

    • Express BioID or APEX2 fused to WDR83OS in various cell types

    • Purify biotinylated proteins and identify by mass spectrometry

    • Validate hits through co-immunoprecipitation and functional assays

  • Crosslinking approaches:

    • Utilize photo-activatable or chemical crosslinkers to capture transient interactions

    • Optimize crosslinking conditions to preferentially capture client proteins during folding

    • Use mass spectrometry to identify crosslinked partners

  • Comparative proteomics:

    • Compare membrane protein composition and folding efficiency in wild-type versus WDR83OS-depleted cells

    • Focus analysis on multi-pass membrane proteins with hydrophilic residues in TMDs

    • Quantify changes in protein levels, membrane integration, and aggregation

  • Pulse-chase experiments:

    • Monitor the fate of newly synthesized membrane proteins in the presence or absence of WDR83OS

    • Identify proteins whose maturation is delayed or compromised when WDR83OS is depleted

    • Focus on proteins that interact with PAT complex during early stages of biogenesis

How do disease-associated variants in WDR83OS affect its molecular function?

Analysis of disease-associated variants in WDR83OS reveals several impacted molecular pathways:

  • Protein structure alterations:

    • Homozygous truncating variants likely result in complete loss of function

    • Missense variants may disrupt specific functional domains, particularly the TMDs that engage client proteins

    • Structural modeling can predict how specific variants affect protein folding or interaction interfaces

  • Disrupted cellular pathways:

    • Neurodevelopmental effects suggest impaired folding of critical neuronal membrane proteins

    • Elevated bile acids (hypercholanemia) in patients indicates disruption of cholesterol/bile acid metabolism

    • Intractable itching suggests potential dysregulation of sensory receptors or inflammatory pathways

  • Experimental approaches for variant characterization:

    • Generate cellular models expressing disease variants using CRISPR/Cas9

    • Assess chaperone activity of wild-type versus mutant WDR83OS using misfolding-prone reporter proteins

    • Perform transcriptomic and proteomic analyses to identify dysregulated pathways

    • Use zebrafish models to correlate molecular defects with developmental outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.