Recombinant Pig Protein ATP1B4 (ATP1B4)
Shipped with Ice Packs 
In Stock 
Description
Introduction to Recombinant Pig Protein ATP1B4
Recombinant Pig Protein ATP1B4 (ATP1B4) is a engineered version of the native βm protein, a member of the X,K-ATPase β-subunit family. While ancestral ATP1B4 genes encode functional Na,K-ATPase β-subunits in non-mammalian vertebrates, eutherians (placental mammals) co-opted ATP1B4 for novel roles in transcriptional regulation and muscle development . The recombinant form is produced via genetic engineering for research into its structural, functional, and evolutionary properties.
Native Protein Properties
Recombinant Protein Design
ATP1B4 is typically expressed in heterologous systems (e.g., E. coli, yeast, or mammalian cells) to study its interactions and regulatory functions:
-
Expression Systems:
Functional Roles
-
Transcriptional Regulation:
-
Metabolic Regulation:
-
Developmental Significance:
Experimental Models
| Model | Observation | Source |
|---|---|---|
| Atp1b4 KO mice | Lower body weight, enhanced glucose tolerance, increased locomotor activity. | |
| C2C12 myoblasts | ATP1B4 activates MyoD expression via DRR binding; independent of SKIP. |
Challenges and Technical Considerations
-
Expression and Purification:
-
Functional Validation:
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATP1B4; Protein ATP1B4; X,K-ATPase subunit beta-m; X/potassium-transporting ATPase subunit beta-m
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MRRQLRSRRAPAFPYGYGYRLDDQDEVNQNYLADEEEEAEEARVMVVPDLEEEEKEEEEE
KEEDEKEEEESHHQDTRSAWWQKLQIVNEYLWDPEKRMSLARTGQSLSLLLVIYFFFYAS
LAAVITLCMYTLFLTISPYVPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISL
NGFLQGYNDSLQEEMNVDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYST
GQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYGKL
THVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET
Uniprot No.
Target Background
Function
ATP1B4 may function as a transcriptional coregulator during muscle development via interaction with SNW1. It has lost its ancestral role as a Na,K-ATPase beta-subunit.
Gene References Into Functions
- Analysis of purified native eutherian BetaM protein reveals structural properties underlying its novel, evolutionarily acquired functions. PMID: 21855530
Database Links
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein. Note=Detected in nuclear envelops.
Tissue Specificity
Expressed in skeletal muscle (at protein level). Expressed during postnatal development in skeletal muscle and heart.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
