Recombinant Pig Selenoprotein S (SELS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for prioritized development.
Synonyms
SELENOS; SELS; Selenoprotein S; SelS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MEQDGDQLSARPALETEGLRFLHVTVGSLLATYGWYIVFCCILLYVVFQKLSTRLRALRQ RHLDGAAAALEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRQKIERWD SVQEGRSYRGDARKRQEEDSPGPSTSSVIPKRKSDKKPLRGGGYNPLSGEGGGACSWRPG RRGPSSGGUG
Uniprot No.

Target Background

Function

Selenoprotein S (SELS) plays a crucial role in the degradation pathway of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of these misfolded proteins from the ER to the cytosol, where subsequent ubiquitin-dependent proteasomal degradation occurs. SELS likely functions as a bridge, connecting DERL1 (mediating retrotranslocation to the cytosol) and the VCP ATPase complex (mediating translocation and ubiquitination).

Database Links
Protein Families
Selenoprotein S family
Subcellular Location
Cytoplasm. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Ubiquitously expressed. Highest expression in liver and lung, with lower levels detected in spleen, kidney, brain, lymph nodes, small intestine, stomach and heart. Very low expression detected in longissimus dorsi.

Q&A

What is Selenoprotein S and what is its basic structure in pigs?

Selenoprotein S (SELS or SelS) is a member of the selenoprotein family that incorporates the trace element selenium. In pigs, SELS encodes a protein of 190 amino acids with an estimated molecular weight of 21.23 kDa and an isoelectric point (pI) of 9.526. The genomic structure, promoter, and deduced amino acid sequence of pig SELS share high similarity with those of human SELS, making it valuable for comparative studies. Like other selenoproteins, SELS contains a selenocysteine residue encoded by the UGA codon, which is normally a stop codon but is recoded to incorporate selenocysteine in these specialized proteins .

What are the primary functions of Selenoprotein S in biological systems?

Selenoprotein S plays important regulatory functions in inflammation and metabolic diseases. Research indicates that SELS is involved in cellular response to inflammatory stimuli, as its expression is upregulated in response to inflammatory conditions in mammalian cells, animal models, and patients. SELS also appears to have roles in cellular stress responses and may be involved in the removal of misfolded proteins from the endoplasmic reticulum. Additionally, SELS is regulated by glucose levels, suggesting a potential role in glucose metabolism and possibly insulin signaling pathways .

How is SELS distributed across different pig tissues?

SELS exhibits a ubiquitous expression pattern across diverse pig tissues, but with notable variations in expression levels. Real-time PCR analysis reveals high expression levels in the liver and lung tissues, with relatively lower expression in other tissues. Muscle tissue in particular shows notably low SELS expression compared to other tissues. This tissue-specific expression pattern suggests that SELS may serve different physiological functions depending on the tissue context, with potentially more significant roles in highly metabolic tissues like liver and lung .

What methodologies are most effective for cloning and expressing recombinant pig SELS?

For effective cloning and expression of recombinant pig SELS, researchers should consider using similar approaches to those that have been successful with other selenoproteins. Based on methodologies used for related selenoproteins, the process typically involves:

  • RNA extraction from pig liver or other high-expressing tissues

  • cDNA synthesis using reverse transcription

  • PCR amplification with specific primers designed based on the pig SELS sequence

  • Cloning into an appropriate expression vector with a selenocysteine insertion sequence (SECIS) element

  • Expression in a system capable of selenocysteine incorporation (specialized E. coli strains or eukaryotic systems)

When expressing recombinant selenoproteins, it's critical to supplement the expression system with sodium selenite to ensure proper incorporation of selenocysteine at the UGA codon .

How can researchers confirm the subcellular localization of recombinant SELS?

To confirm the subcellular localization of recombinant SELS, fluorescence microscopy with fusion proteins has proven effective. Research has demonstrated that pig SELS fusion proteins localize to the cytoplasm. The recommended methodology includes:

  • Creating fusion constructs with fluorescent tags (such as GFP) attached to either the N- or C-terminus of SELS

  • Transfecting these constructs into appropriate cell lines

  • Using fluorescence microscopy to visualize the subcellular distribution

  • Conducting co-localization studies with organelle-specific markers to confirm precise localization

This approach allows researchers to determine whether recombinant SELS localizes similarly to endogenous SELS and to identify any potential mislocalization that might affect functional studies .

What are the key considerations when designing primers for SELS gene amplification?

When designing primers for SELS gene amplification, researchers should consider several factors specific to selenoprotein genes:

  • The UGA codon that encodes selenocysteine must be preserved and not mistaken for a stop codon during primer design

  • Include adequate flanking regions around the coding sequence to capture regulatory elements

  • Consider the high sequence similarity between pig and human SELS (reported similarity in the coding and promoter regions) to avoid cross-reactivity

  • Include appropriate restriction enzyme sites to facilitate subsequent cloning steps

Additionally, researchers should design primers that allow for melting curve analysis to confirm specific amplification, as has been done for other selenoprotein genes in pigs. Verification methods such as those shown in the supplemental figures referenced in the search results should be employed to ensure specificity .

How does NF-κB regulate SELS transcription in inflammatory responses?

NF-κB plays a crucial role in regulating SELS transcription during inflammatory responses. Promoter deletion analysis has identified an NF-κB binding site within the SELS promoter that is responsible for the up-regulation of SELS transcription in response to inflammatory stimuli. This regulatory mechanism explains why SELS expression increases during inflammation in mammalian cells, animal models, and patients with inflammatory conditions.

The process likely involves:

  • Inflammatory stimuli activating the NF-κB signaling pathway

  • Translocation of NF-κB to the nucleus

  • Binding of NF-κB to its recognition site in the SELS promoter

  • Enhanced transcription of the SELS gene

This NF-κB-dependent regulation suggests that SELS may be part of the cellular defense mechanism against inflammatory damage, potentially through its roles in reducing oxidative stress or endoplasmic reticulum stress .

How does dietary selenium affect SELS expression compared to other selenoproteins?

Dietary selenium affects SELS expression in a complex, tissue-specific manner that differs from the regulation patterns of other selenoproteins. Research shows that SELS protein abundance in tissues responds to dietary selenium concentrations in three distinct patterns:

  • Downregulation in selenium deficiency (observed in liver, kidney, and muscle)

  • Increased expression with high selenium intake (3.0 mg Se/kg) compared to adequate intake (0.3 mg Se/kg) in thyroid tissue

  • No response to dietary selenium changes in certain tissues like heart

This contrasts with some other selenoproteins that show more consistent responses across tissues. The varied response patterns indicate that transcriptional and post-transcriptional regulatory mechanisms for SELS are tissue-specific and likely involve complex interactions with other cellular pathways beyond simple selenium availability .

What is the relationship between SELS regulation and glucose metabolism?

SELS shows a notable relationship with glucose metabolism, as it is regulated by glucose levels. This connection may be significant in understanding the role of selenium in insulin signaling and diabetes risk. Research indicates that:

  • SELS is regulated by glucose levels, suggesting involvement in glucose sensing or response pathways

  • High selenium intake (3.0 mg Se/kg) in pigs led to hyperinsulinemia compared to those receiving adequate selenium (0.3 mg Se/kg)

  • Pigs with high selenium intake had lower tissue levels of serine/threonine protein kinase (Akt), a central protein in insulin signaling

These findings suggest that SELS may be part of the molecular mechanism linking selenium status to glucose homeostasis and insulin function. The exact signaling pathways involved require further investigation, but likely involve interactions between SELS, glucose sensing mechanisms, and insulin signaling components .

What are the optimal conditions for measuring SELS mRNA expression in pig tissues?

For optimal measurement of SELS mRNA expression in pig tissues, researchers should follow these methodological guidelines:

  • Tissue collection and processing:

    • Collect diverse tissues (liver, kidney, muscle, testis, thyroid, pituitary, spleen, heart, hypothalamus, and blood)

    • Process tissues rapidly to prevent RNA degradation

    • Store samples at -80°C until RNA extraction

  • RNA isolation and quality control:

    • Use specialized RNA isolation methods appropriate for specific tissues

    • Verify RNA integrity using gel electrophoresis or Bioanalyzer

    • Treat samples with DNase to eliminate genomic DNA contamination

  • qPCR analysis:

    • Design primers specific to pig SELS (consider available sequence information)

    • Include appropriate reference genes (β-actin and GAPDH have been successfully used)

    • Use the 2^(-ΔΔCt) method for relative quantification

    • Perform melting curve and cycle threshold analyses to confirm specific amplification

These approaches have been successfully employed for analyzing selenoprotein gene expression in pig tissues and should be equally applicable to SELS .

What challenges exist in detecting SELS protein levels in different pig tissues?

Detecting SELS protein levels in different pig tissues presents several challenges that researchers should be prepared to address:

  • Antibody selection and validation:

    • Limited availability of pig-specific SELS antibodies

    • Need to validate cross-reactivity of human or other mammalian SELS antibodies with pig SELS

    • Testing multiple antibodies from different sources may be necessary

  • Tissue-specific considerations:

    • Variable expression levels (particularly low in muscle tissue)

    • Potential interference from tissue-specific proteins

    • Need for optimized protein extraction protocols for each tissue type

  • Quantification challenges:

    • Selection of appropriate loading controls for normalization

    • Need for replicate samples to enable statistical analysis

    • Potential post-translational modifications affecting detection

Researchers have successfully addressed these challenges for other selenoproteins by identifying appropriate antibodies from multiple sources and optimizing protocols for each tissue type .

How should selenium supplementation be designed in experimental studies of SELS?

When designing selenium supplementation protocols for experimental studies of SELS, researchers should consider:

  • Selenium concentration range:

    • Include selenium-deficient group (<0.03 mg Se/kg diet)

    • Include adequate selenium group (approximately 0.3 mg Se/kg diet)

    • Include high selenium group (1.0-3.0 mg Se/kg diet)

  • Selenium source selection:

    • Sodium selenite or selenium-enriched yeast (as used in previous studies)

    • Consider differences in bioavailability between inorganic and organic forms

  • Experimental duration:

    • Allow sufficient time for selenium status equilibration (previous studies used 16 weeks)

    • Consider time points for interim measurements

  • Monitoring parameters:

    • Measure plasma and tissue selenium concentrations

    • Assess functional markers like glutathione peroxidase activity

    • Monitor for potential adverse effects at high doses

This design allows for assessment of SELS response across a spectrum of selenium statuses, from deficiency to excess, providing comprehensive data on regulation patterns .

How does SELS function differ between pigs and humans?

While pig and human SELS share high sequence similarity and likely have similar core functions, some differences may exist:

  • Structural comparison:

    • Pig SELS shows high sequence homology with human SELS

    • The genomic structure, promoter, and amino acid sequence are highly similar

    • The regulatory elements, including the NF-κB binding site, appear to be conserved

  • Tissue distribution:

    • Both species show ubiquitous expression with tissue-specific variations

    • Some differences may exist in relative expression levels across tissues

  • Regulatory responses:

    • Both respond to inflammatory stimuli via NF-κB pathways

    • Both are regulated by selenium status

    • The glucose regulation appears similar, with implications for metabolic function

The high degree of conservation suggests that pigs may serve as a good model for human SELS function, particularly for studying relationships between selenium status, SELS function, and glucose metabolism .

What evidence links SELS to insulin signaling and diabetes risk?

Several lines of evidence link SELS to insulin signaling and diabetes risk:

  • Glucose regulation:

    • SELS is regulated by glucose levels, suggesting involvement in glucose sensing or response pathways

  • Insulin pathway interactions:

    • Pigs fed high selenium diets (3.0 mg Se/kg) became hyperinsulinemic compared to those fed adequate selenium (0.3 mg Se/kg)

    • High selenium intake was associated with lower tissue levels of serine/threonine protein kinase (Akt), a central component of insulin signaling

  • Human correlation studies:

    • The research notes that "a number of human studies have suggested a surprising link between high body Se status and adverse blood profiles of glucose and lipid or diabetic susceptibility"

    • This correlation appears to be reproducible across multiple studies

These findings suggest that SELS may be part of the molecular mechanism explaining the observed association between high selenium status and increased diabetes risk in humans, making it an important target for metabolic research .

How might SELS interact with other selenoproteins in inflammatory responses?

SELS likely interacts with other selenoproteins in a complex network during inflammatory responses:

  • Complementary functions:

    • While SELS is upregulated by NF-κB during inflammation, other selenoproteins like glutathione peroxidases (GPX) directly combat oxidative stress

    • SELS may work in concert with these antioxidant selenoproteins to provide a multi-faceted response to inflammation

  • Selenium prioritization:

    • Under selenium limitation, certain selenoproteins may be preferentially synthesized over others

    • The hierarchy of selenoprotein expression during inflammation remains to be fully characterized

  • Tissue-specific interactions:

    • The study shows that different selenoproteins respond differently to selenium status across tissues

    • This suggests tissue-specific interaction networks where SELS may play varying roles depending on the local selenoprotein profile

Understanding these interactions is important for developing a comprehensive view of how selenium status affects inflammatory responses and may explain why simple selenium supplementation does not always yield predictable anti-inflammatory effects .

What is the comparative expression of SELS across different pig tissues?

While the search results don't provide a complete quantitative comparison of SELS expression across all pig tissues, they do indicate that SELS shows a ubiquitous expression pattern with significant variations between tissues. Based on real-time PCR analysis:

TissueRelative SELS Expression
LiverHigh
LungHigh
MuscleLow
Other tissuesIntermediate

This tissue-specific expression pattern suggests differentiated roles for SELS depending on the tissue context. The high expression in metabolically active tissues like liver suggests a potential role in metabolic processes, while the low expression in muscle is notable and may be relevant to understanding tissue-specific effects of selenium deficiency or excess .

How does dietary selenium affect SELS protein abundance compared to other selenoproteins?

The effect of dietary selenium on SELS protein abundance shows tissue-specific patterns that differ from some other selenoproteins:

TissueSELS Response PatternComparison to Other Selenoproteins
LiverPattern 1: Downregulated in Se deficiencySimilar to Gpx1 and Sepp1
KidneyPattern 1: Downregulated in Se deficiencySimilar to Gpx1 and Sepp1
MusclePattern 1: Downregulated in Se deficiencySimilar to Gpx1 and Sepp1
ThyroidPattern 2: Further increased at 3.0 mg Se/kg vs. 0.3 mg Se/kgSimilar to Sepp1; different from Gpx1 (Pattern 1)
HeartPattern 3: No response to dietary SeSimilar to Sepp1; different from most other selenoproteins
TestisInsufficient replication for statistical analysisVariable among selenoproteins

These diverse response patterns indicate that transcriptional and post-transcriptional regulation of SELS is complex and tissue-specific, with no common regulation pattern across all tissues .

What selenium concentrations are optimal for studying SELS regulation in experimental models?

Based on research findings, the following selenium concentration ranges are recommended for comprehensive study of SELS regulation:

Selenium StatusDiet ConcentrationResulting Plasma Se (mmol/L)Resulting Liver Se (nmol/g tissue)
Deficient<0.03 mg Se/kg0.02 ± 0.010.1 ± 0.05
Adequate0.3 mg Se/kg0.21 ± 0.010.7 ± 0.06
Excess3.0 mg Se/kg0.51 ± 0.222.6 ± 0.91

These concentrations create clearly differentiated selenium status groups that allow researchers to observe the full spectrum of SELS responses. The adequate level (0.3 mg Se/kg) represents a physiologically relevant baseline, while the excess level (3.0 mg Se/kg) allows observation of potential dysregulation associated with high selenium intake .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.