Recombinant Pig Signal peptidase complex subunit 1 (SPCS1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Signal Peptidase Complex Subunit 1 (SPCS1)

Recombinant Pig Signal Peptidase Complex Subunit 1 (SPCS1) is a bioengineered protein derived from the Sus scrofa (pig) genome. It is a component of the microsomal signal peptidase complex, which catalyzes the cleavage of signal peptides from nascent secretory or membrane-associated proteins during their translocation into the endoplasmic reticulum . This recombinant version is produced via heterologous expression systems, enabling studies on its structure, function, and interactions in both basic research and virology.

Gene and Protein Details

  • Gene Names: SPCS1, SPC12

  • Protein Names: Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit .

  • Host Systems: Produced in E. coli, yeast, baculovirus, mammalian cells, or cell-free expression systems .

  • Purity: ≥85% as determined by SDS-PAGE .

Sequence and Modifications

FeatureDetails
Expression RegionFull-length (1–102 aa) or partial sequences (e.g., 1–80 aa) .
TagsN-terminal 10xHis-tag in some constructs .
Molecular Weight~9.3 kDa (partial sequence) .

Role in Protein Processing

SPCS1 participates in the signal peptidase complex, which removes signal peptides from precursor proteins. This process is critical for proper protein folding and targeting to cellular membranes or secretion pathways .

Interaction with Hepatitis C Virus (HCV)

SPCS1 has been implicated in HCV assembly through its interaction with nonstructural protein 2 (NS2) and structural protein E2 . Key findings include:

  1. NS2-E2 Complex Formation: SPCS1 facilitates the assembly of the membrane-associated NS2-E2 complex, linking structural and nonstructural proteins during virion formation .

  2. Impact of Knockdown: Silencing SPCS1 reduces infectious HCV titers by ~95% without affecting RNA replication or structural protein processing .

  3. Domain Specificity: NS2’s transmembrane domains (TM2 and TM3) are critical for SPCS1 binding, as shown by co-immunoprecipitation assays .

Experimental Uses

  • Co-Immunoprecipitation: To study interactions with viral proteins (e.g., HCV NS2/E2) .

  • Antibody Development: SPCS1-specific antibodies enable immunofluorescence and ELISA assays .

Research Gaps and Opportunities

  • Mechanistic Studies: Elucidating how SPCS1 stabilizes NS2-E2 interactions during HCV assembly.

  • Therapeutic Potential: Targeting SPCS1 in HCV treatment without disrupting host protein processing .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
SPCS1; SPC12; Signal peptidase complex subunit 1; Microsomal signal peptidase 12 kDa subunit; SPase 12 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
SPCS1
Target Protein Sequence
MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQDSGTEDKKPGERKIKRHAKNN
Uniprot No.

Target Background

Function
Signal peptidase complex subunit 1 (SPCS1) is a component of the microsomal signal peptidase complex. This complex is responsible for removing signal peptides from newly synthesized proteins as they are translocated into the lumen of the endoplasmic reticulum.
Database Links
Protein Families
SPCS1 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Signal Peptidase Complex Subunit 1 in cellular processes?

SPCS1 functions as a component of the microsomal signal peptidase complex that cleaves signal peptides from many secreted and membrane-associated proteins. Despite being part of this complex, SPCS1 is not absolutely essential for all signal peptidase activity. Studies with the yeast homolog of SPCS1 (Spc1p) demonstrated it was nonessential for signal peptidase activity and cell survival .

How does SPCS1 participate in viral infection cycles?

SPCS1 plays crucial roles in the replication of multiple Flaviviridae family viruses through specific protein-protein interactions. For Japanese Encephalitis Virus (JEV), SPCS1 interacts with nonstructural protein 2B (NS2B), affecting viral replication by influencing posttranslational processing of viral proteins and virion assembly .

This interaction is specific to the posttranslational protein processing and viral assembly stages but does not affect cell entry, RNA replication, or translation of the virus . When SPCS1 function is lost through knockout or knockdown, there is markedly reduced intracellular virion assembly and production of infectious JEV particles .

For Hepatitis C Virus (HCV), SPCS1 specifically regulates the processing of the E2-p7 junction by the signal peptidase complex. This processing step is critical for viral assembly, and efficient separation of E2 and p7 is dependent on SPCS1 . Through interactions with both NS2 and E2 proteins in HCV, SPCS1 facilitates the formation of a membrane-associated complex essential for coordinating interactions between structural and non-structural proteins during virion assembly .

What experimental evidence demonstrates SPCS1's role in flavivirus replication?

Multiple experimental approaches have established SPCS1's critical role in flavivirus replication:

  • Knockout studies: CRISPR-Cas9-mediated SPCS1 knockout in HEK-293 cells significantly reduced JEV infectivity, with viral titers in culture supernatant markedly lower than in wild-type cells at 24, 48, and 72 hours post-infection . The cytopathic effects of JEV infection were almost completely eliminated in SPCS1 knockout cells .

  • Complementation experiments: Transfection of SPCS1-expressing plasmids into SPCS1 knockout cells restored the ability of cells to support viral replication, confirming the specificity of SPCS1's role .

  • Protein interaction studies: Using a Venus-based Bimolecular Fluorescence Complementation (BiFC) system, researchers demonstrated that SPCS1 interacts strongly with NS2B protein from multiple flaviviruses including JEV, WNV, and ZIKV .

  • Single-round infectious reporter systems: Using a JEV reporter replicon particle packaging system, researchers showed that SPCS1 knockout cells could not produce infectious virus particles, while infectious viruses were recovered when SPCS1 was complemented by transfection .

  • Ultrastructural studies: Negative-staining electron microscopy confirmed defects in virus particle assembly in SPCS1 knockout cells .

What are effective approaches for generating and validating SPCS1 knockout cell lines?

Based on published research, effective approaches for generating SPCS1 knockout cell lines include:

  • CRISPR-Cas9 system: Transfection of HEK-293 cells with CRISPR-Cas9 components targeting SPCS1 has been successfully used to generate knockout cell lines . This approach allows for complete elimination of SPCS1 expression.

  • siRNA knockdown: Multiple siRNAs with different target sequences can be used to achieve varying levels of SPCS1 knockdown. In previous studies, researchers tested four SPCS1-siRNAs and identified siRNA #2 as providing the highest knockdown efficiency .

For validation of knockout or knockdown, researchers should:

  • Confirm protein absence: Western blotting to verify the absence of SPCS1 protein expression.

  • Functional validation: Test the cells' ability to support viral replication, which should be significantly reduced in SPCS1 knockout/knockdown cells.

  • Complementation testing: Transfect SPCS1-expressing plasmids into knockout cells to restore viral replication, which confirms the specificity of the phenotype to SPCS1 loss .

  • Microscopy: Both light microscopy and staining with crystal violet can be used to visualize the reduction in cytopathic effects caused by viral infection in SPCS1 knockout cells .

What protein interaction assays are most effective for studying SPCS1-viral protein complexes?

Several protein interaction assays have proven effective for studying SPCS1-viral protein interactions:

  • Bimolecular Fluorescence Complementation (BiFC) system: This has been successfully used to demonstrate interactions between SPCS1 and viral proteins. The technique involves fusing SPCS1 with the N-terminal portion of Venus protein (VN) and viral proteins with the C-terminal portion (VC). When the proteins interact, the fluorescent protein fragments reconstitute, producing detectable fluorescence .

  • Co-immunoprecipitation assays: These have been used to demonstrate the formation of complexes containing SPCS1, NS2, and E2 in HCV-infected cells .

  • Mutagenesis analysis: Systematic mutation of conserved amino acid residues in viral proteins has helped identify specific residues critical for interactions with SPCS1. For example, mutations G12A, G37A, and G47A in NS2B(1-49) and P112A in NS2B(84-131) weakened interactions with SPCS1 .

  • High-content screening systems: These automated systems can quantify the ratio of positive cells in BiFC assays, providing quantitative measures of protein-protein interactions .

How can researchers investigate the effect of SPCS1 on viral polyprotein processing?

To investigate SPCS1's effect on viral polyprotein processing, researchers can employ these methodological approaches:

  • Ectopic protein expression systems: Co-transfection of plasmids encoding viral polyprotein segments (e.g., E1-E2-p7 for HCV) in SPCS1(+) or SPCS1(-) cells, followed by Western blotting to detect processed and unprocessed forms .

  • Rescue experiments: Co-transfection of viral protein-encoding plasmids with SPCS1-expressing plasmids in SPCS1(-) cells to demonstrate specific rescue of processing defects .

  • Comparative analysis across viral strains: Testing multiple viral genotypes (e.g., gt1a H77-derived and gt2a JFH1 for HCV) to determine conservation of SPCS1-dependent processing mechanisms .

  • Time-course experiments: Electroporation of viral RNA into SPCS1(+) or SPCS1(-) cells followed by monitoring viral RNA levels over time (24, 48, 72, 96 hours) to assess effects on viral replication dynamics .

  • Analysis of replication-defective controls: Include replication-defective viral RNA (e.g., JFH1/GND with NS5B polymerase active site mutation) to distinguish effects on RNA stability from effects on replication .

How does SPCS1 specifically interact with viral proteins during replication?

SPCS1 interacts with viral proteins in a highly specific manner that appears to be conserved across multiple flaviviruses:

  • Interaction with NS2B in flaviviruses: For JEV, SPCS1 strongly interacts with two transmembrane domains of NS2B: NS2B(1-49) and NS2B(84-131). This interaction pattern is conserved for NS2B proteins from WNV and ZIKV .

  • Transmembrane domain involvement: The region of SPCS1(91-169), which contains two transmembrane domains, is involved in interactions with both NS2B(1-49) and NS2B(84-131) .

  • Critical residues for interaction: Mutagenesis studies identified conserved flavivirus residues that are important for SPCS1 interaction. Mutations G12A, G37A, and G47A in NS2B(1-49) and P112A in NS2B(84-131) significantly reduced interactions with SPCS1 .

  • HCV-specific interactions: For HCV, SPCS1 forms a complex with both NS2 and E2 proteins. Knockdown of SPCS1 impairs the interaction between NS2 and E2, suggesting that SPCS1 plays a key role in facilitating this interaction .

These specific protein-protein interactions appear to be essential for the role of SPCS1 in viral replication, particularly in coordinating the association between structural and non-structural proteins during assembly.

What is the mechanism by which SPCS1 affects HCV E2-p7 processing?

SPCS1 specifically regulates the processing of the HCV E2-p7 junction by the signal peptidase complex through the following mechanism:

  • Junction-specific effect: Loss of SPCS1 specifically impairs the signal peptidase complex (SPC)-mediated processing of the E2-p7 junction without affecting other processing sites such as E1-E2 .

  • Genotype conservation: This specific effect on E2-p7 processing is observed in both genotype 1a (H77-derived) and genotype 2a (JFH1) HCV proteins, indicating conservation of this mechanism across HCV strains .

  • Processing regulation: When SPCS1 is absent, there is an accumulation of unprocessed E2-p7 precursor proteins. This is evidenced by the appearance of higher-molecular-mass bands detectable with anti-E2 antibodies .

  • Functional consequence: The impaired E2-p7 processing in SPCS1-deficient cells leads to defects in viral assembly and reduced production of infectious virus particles .

  • Assembly dependence: Research has shown that efficient separation of E2 and p7, regardless of its dependence on SPC-mediated processing, is the key determinant of whether SPCS1 is required for HCV assembly .

This mechanism explains why SPCS1 is essential for HCV assembly and provides insight into the specific step at which SPCS1 functions in the viral life cycle.

How does SPCS1 contribute to JEV assembly and what are the key experimental findings?

SPCS1 plays a crucial role in JEV assembly through interactions with viral proteins. Key experimental findings include:

  • Stage-specific involvement: SPCS1 participates specifically in the posttranslational protein processing and viral assembly stages of the JEV life cycle, not affecting cell entry, genome RNA replication, or translation .

  • NS2B interaction: SPCS1 interacts with NS2B, which is involved in posttranslational protein processing and virus assembly. This interaction involves two transmembrane domains of NS2B: NS2B(1-49) and NS2B(84-131) .

  • Impact on virion production: In SPCS1 knockout cells, intracellular virion assembly and production of infectious JEV particles are markedly reduced .

  • Quantifiable effects: Loss of SPCS1 function reduced viral titers in culture supernatants by approximately 2-3 log units compared to wild-type cells .

  • Protein processing effects: In SPCS1 knockout cells, researchers observed altered patterns of viral protein expression, with higher-molecular-mass bands reacting with anti-E, anti-prM/M, and anti-NS1 antibodies, suggesting defects in protein processing .

These findings demonstrate that SPCS1 is essential for proper assembly of JEV virions, likely by facilitating the correct processing and interactions of viral proteins during the assembly process.

How does SPCS1 dependence vary across different flaviviruses?

SPCS1 dependence shows both similarities and differences across flaviviruses:

  • Broad requirement: SPCS1 is required for the efficient replication of multiple Flaviviridae family viruses, including JEV, WNV, DENV, ZIKV, YFV, and HCV .

  • Processing site specificity: For flaviviruses like JEV and WNV, SPCS1 is particularly important for the cleavage of the C-prM junction, while for HCV, it specifically affects the processing of the E2-p7 junction .

  • Protein interaction patterns: SPCS1 interacts with NS2B in flaviviruses like JEV, WNV, and ZIKV, whereas in HCV, it forms a complex with both NS2 and E2 proteins .

  • Viral family specificity: The effect of SPCS1 appears to be specific to Flaviviridae family viruses, with little impact on the production of alpha viruses, bunyaviruses, rhabdoviruses, and the surface expression or secretion of diverse host proteins, despite all these processes requiring SPC-mediated signal sequence processing .

This pattern suggests that while SPCS1 is broadly required for Flaviviridae replication, the specific mechanisms and viral protein interactions may vary across different viruses within this family.

What are the implications of SPCS1 research for antiviral drug development?

Research on SPCS1 has several important implications for antiviral drug development:

  • Novel target identification: The specific role of SPCS1 in flavivirus replication identifies it as a potential host-directed antiviral target, which could have advantages over viral protein targets in terms of reduced resistance development.

  • Broad-spectrum potential: Since SPCS1 is required for multiple flaviviruses (JEV, WNV, DENV, ZIKV, YFV, and HCV), targeting SPCS1-viral protein interactions could potentially yield broad-spectrum antivirals against the Flaviviridae family .

  • Specific interaction targeting: The identified protein-protein interactions between SPCS1 and viral proteins (NS2B in flaviviruses, NS2/E2 in HCV) provide specific molecular targets for small-molecule drug development .

  • Critical amino acid residues: Mutagenesis studies have identified specific amino acid residues important for SPCS1-viral protein interactions, such as G12A, G37A, G47A in NS2B(1-49) and P112A in NS2B(84-131), which could guide the design of peptide-based inhibitors .

  • Reduced host toxicity potential: The observation that SPCS1 loss has little impact on host protein processing or non-flavivirus replication suggests that targeting SPCS1-viral protein interactions might offer specificity with minimal host toxicity .

What are the current limitations in SPCS1 research and future directions?

Current limitations and future research directions for SPCS1 include:

  • Structural characterization: Detailed structural information about SPCS1 and its interactions with viral proteins is currently limited. Future research should focus on solving crystal structures of SPCS1 alone and in complex with viral proteins.

  • Mechanism elucidation: While SPCS1's role in viral replication has been established, the precise molecular mechanism by which it facilitates specific protein processing steps remains incompletely defined .

  • In vivo validation: Most studies have been conducted in cell culture systems. Validation of SPCS1's role in viral pathogenesis using animal models would strengthen its candidacy as an antiviral target.

  • Species differences: Comparative studies of human versus pig SPCS1 would be valuable for understanding potential species-specific differences in function and viral interactions.

  • Global effects assessment: Comprehensive analysis of how SPCS1 knockout affects global cellular protein processing beyond viral proteins would provide important insights into potential off-target effects of SPCS1-targeted therapeutics.

  • Small molecule inhibitor development: Development and testing of small molecules that specifically disrupt SPCS1-viral protein interactions without affecting essential cellular functions represents an important future direction.

What control experiments are essential when studying recombinant pig SPCS1?

When studying recombinant pig SPCS1, several essential control experiments should be included:

  • Knockout validation controls:

    • Western blotting to confirm complete absence of SPCS1 protein

    • Complementation with SPCS1-expressing plasmids to rescue phenotypes

    • Use of scrambled/control siRNAs when performing knockdown experiments

  • Viral replication controls:

    • Include replication-defective viral constructs (e.g., JFH1/GND) to distinguish effects on RNA stability from effects on replication

    • Test multiple viral strains/genotypes to ensure observed effects are not strain-specific

  • Protein interaction controls:

    • Include negative control protein pairs known not to interact in BiFC assays

    • Test multiple viral proteins to confirm specificity of interactions

    • Use mutated versions of viral proteins to validate specific interaction domains

  • Processing assay controls:

    • Monitor multiple cleavage sites to confirm specificity of effects on particular junctions

    • Include both wild-type and mutated cleavage sites to validate specificity

  • Functional rescue experiments:

    • Complementation with wild-type SPCS1 to restore function

    • Domain-specific complementation to identify essential functional regions

    • Cross-species complementation to assess functional conservation

How should researchers address potential confounding factors in SPCS1 viral studies?

Researchers should address several potential confounding factors when studying SPCS1's role in viral replication:

  • Cell type differences:

    • Test multiple cell lines to ensure observations are not cell-type specific

    • Consider the endogenous expression level of SPCS1 in different cell types

    • Account for differences in signal peptidase complex composition across cell types

  • Viral strain variations:

    • Use multiple viral strains/genotypes to confirm conservation of mechanisms

    • Consider potential adaptations that might arise during passaging of virus

  • Expression level effects:

    • Control for expression levels when comparing wild-type and mutant proteins

    • Use inducible expression systems to modulate SPCS1 levels

  • Temporal considerations:

    • Conduct time-course experiments to distinguish early vs. late effects in the viral life cycle

    • Consider the possibility of compensatory mechanisms that develop over time

  • Indirect effects:

    • Distinguish direct effects on viral replication from indirect effects on cell health

    • Monitor cell viability and proliferation in parallel with viral replication assays

    • Use relevant controls to distinguish specific virus-related phenotypes from general cellular responses

  • Technical variables:

    • Standardize infection conditions (MOI, time of analysis)

    • Use multiple methodologies to confirm key findings

    • Quantify results using appropriate statistical analyses

What are the key considerations for translating in vitro SPCS1 findings to in vivo applications?

Translating in vitro findings about SPCS1 to in vivo applications requires careful consideration of several factors:

  • Physiological relevance:

    • Consider differences in SPCS1 expression levels across tissues and cell types

    • Account for the complex environment of intact tissues versus cell culture

    • Evaluate potential compensatory mechanisms that may exist in vivo but not in vitro

  • Species differences:

    • Consider sequence and functional differences between pig, human, and model organism SPCS1

    • Validate key findings in species-appropriate models

  • Temporal dynamics:

    • In vivo infections may have different kinetics than in vitro systems

    • Design experiments with appropriate time points to capture relevant stages of infection

  • Immune system interactions:

    • Consider how immune responses, absent in most in vitro systems, might affect SPCS1-dependent viral processes

    • Evaluate potential immunomodulatory effects of targeting SPCS1

  • Delivery and biodistribution:

    • For therapeutic applications, consider how to deliver SPCS1-targeting agents to relevant tissues

    • Evaluate potential off-target effects in non-infected tissues

  • Safety assessment:

    • Although SPCS1 appears dispensable for many cellular functions, comprehensive safety evaluation in vivo is essential

    • Consider potential developmental or tissue-specific roles of SPCS1 not evident in cell culture

  • Validation in relevant models:

    • Use appropriate animal models that recapitulate human disease

    • Consider humanized models where appropriate to account for species-specific differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.