Recombinant Pig Solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for preferential development.
Synonyms
SLC2A2; GLUT2; Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
VCAIFMSVGLVLLDKLPWMSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPAALA MAAFSNWTRNFIIALCFQYIADFCGPYVFFLFAGVVLVFTLFTFFKVPETKGKSFEEIAA
Uniprot No.

Target Background

Function
Recombinant Pig Solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2) is a facilitative hexose transporter mediating glucose and fructose transport. It likely facilitates bidirectional glucose transfer across hepatocyte plasma membranes and is crucial for glucose uptake in beta cells, potentially contributing to their glucose-sensing mechanism. It may also cooperate with the Na+/glucose cotransporter in transcellular glucose transport within the small intestine and kidney. Additionally, it can transport dehydroascorbate.
Database Links
Protein Families
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of pig SLC2A2?

Pig SLC2A2 (GLUT2) is a 524-amino acid membrane-associated protein belonging to the Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily. It functions as a facilitative hexose transporter that mediates the bidirectional transport of glucose and fructose across plasma membranes. It is responsible for glucose uptake by beta cells and may comprise part of the glucose-sensing mechanism of the beta cell. Additionally, it can mediate the transport of dehydroascorbate. The protein contains several glycosylation sites that are important for its function .

How does pig SLC2A2 differ from SLC2A2 in other species?

While the core function remains similar across species, pig SLC2A2 has unique expression patterns during development. Unlike human or mouse models, pig SLC2A2 shows distinctive temporal expression in reproductive tissues. Studies have shown that porcine SLC2A2 mRNA increases significantly in endometria between days 25 and 60 of pregnancy and in placenta between days 30 and 85 . When designing experiments involving recombinant pig SLC2A2, researchers should consider these species-specific characteristics rather than directly extrapolating from rodent models.

Where is SLC2A2 expressed in porcine tissues?

In pigs, SLC2A2 is expressed primarily in:

  • Liver hepatocytes (highest expression)

  • Pancreatic β-cells

  • Small intestine

  • Kidney proximal tubules

  • Reproductive tissues (specifically in the trophectoderm of day 15 conceptuses and in areolae with increasing expression through day 60 of pregnancy)

The expression pattern in porcine tissues mirrors the expression in other mammals but with tissue-specific temporal variations, particularly in reproductive tissues during pregnancy.

What expression systems are optimal for producing recombinant pig SLC2A2?

For functional recombinant pig SLC2A2, mammalian expression systems typically yield better results than bacterial systems due to the need for proper post-translational modifications, particularly glycosylation. The recommended expression systems include:

Expression SystemAdvantagesLimitationsBest For
HEK293F cellsProper glycosylation, high yieldMore expensiveFunctional studies
CHO cellsStable glycosylation patternsSlower growthLarge-scale production
Baculovirus/insect cellsLower cost than mammalian cellsDifferent glycosylationStructural studies
Xenopus oocytesExcellent for transport studiesLimited scaleFunctional characterization

For studies requiring functional transport activity, Xenopus oocyte expression systems have proven particularly valuable as demonstrated in genotype-phenotype correlation studies of SLC2A2 variants .

What strategies can improve the yield of correctly folded recombinant pig SLC2A2?

Membrane proteins like SLC2A2 present challenges for recombinant expression. To improve yield:

  • Optimize codon usage for the expression system

  • Use fusion tags that enhance folding (e.g., thioredoxin)

  • Consider using the 2A peptide-based expression system, which has shown success in expressing multiple proteins in pigs with high efficiency

  • Include molecular chaperones in the expression system

  • Implement temperature optimization during expression (typically lower temperatures slow protein production and improve folding)

  • Use detergents specifically optimized for glucose transporters during purification

The 2A peptide approach has demonstrated particular promise for multi-gene transfer in pigs, with studies showing uniform high-level expression of proteins when using this strategy .

What methods are most reliable for assessing recombinant pig SLC2A2 transport activity?

Several complementary approaches provide robust functional assessment:

  • Radiolabeled substrate uptake assays: Measuring the uptake of 3H-labeled 2-deoxyglucose provides quantitative transport data

  • Fluorescent glucose analogs: Using 2-NBDG (2-(N-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)amino)-2-deoxyglucose) allows real-time monitoring of transport

  • Patch-clamp electrophysiology: For detailed kinetic analysis

  • Xenopus oocyte expression system: Particularly valuable for comparing wild-type versus mutant transporters, as demonstrated in studies of SLC2A2 variants

Transport studies in Xenopus oocytes have been instrumental in establishing genotype-phenotype correlations for SLC2A2 variants, with specific variants (such as p.153_4delLI) showing partial retained transport activity (approximately 5.8%) for 2-deoxyglucose .

How should researchers evaluate the correct membrane localization of recombinant pig SLC2A2?

Confirming proper cellular localization is critical and should involve multiple approaches:

  • Immunofluorescence microscopy: Using anti-SLC2A2 antibodies to visualize membrane localization

  • Cell surface biotinylation: To quantify the proportion of transporter at the plasma membrane

  • Membrane fractionation: To biochemically separate membrane-bound from internal protein

  • Confocal microscopy: For co-localization studies with membrane markers

When conducting these studies, it is important to note that antibodies that cross-react with porcine SLC2A2 may be limited. Previous research has reported difficulties finding antibodies that cross-reacted with porcine SLC2A2 proteins , suggesting researchers should validate antibodies carefully or develop pig-specific antibodies.

How can recombinant pig SLC2A2 variants be used to model human glucose transporter deficiencies?

Recombinant pig SLC2A2 variants offer valuable models for human diseases like Fanconi-Bickel syndrome (FBS):

  • Generate constructs with specific mutations corresponding to human disease variants

  • Express these in appropriate cellular systems (Xenopus oocytes have been particularly useful)

  • Assess membrane expression and transport function quantitatively

  • Correlate functional deficits with clinical severity

Studies have established genotype-phenotype correlations where non-functional variants result in the full picture of FBS, while dysfunctional variants with residual activity (5-8%) result in milder presentations, sometimes with glucosuria as the only symptom . This approach allows prediction of clinical outcomes based on the degree of transporter dysfunction.

What considerations are important when designing pig models with SLC2A2 mutations?

When designing pig models with SLC2A2 mutations, researchers should consider:

  • Selection of targeting strategy: CRISPR/Cas9 versus homologous recombination

  • Choice of mutation: Consider variants with established human phenotypes

  • Tissue-specificity: Use pancreas-specific Cre driver lines like those established in mice (Tg(Ins2-cre)5Lt or similar) if global knockout is lethal

  • Potential compensatory mechanisms: Monitor expression of other glucose transporters (SLC2A1, SLC2A3, SLC2A4)

  • Developmental timing: Implement inducible systems to bypass embryonic lethality

When using Cre/LoxP systems for conditional modification, careful selection of the Cre driver is critical. Pancreas-specific drivers like those targeting the insulin promoter have proven valuable in mice and may be adapted for porcine models .

How do polymorphisms in pig SLC2A2 compare to human variants associated with type 2 diabetes risk?

Human studies have identified several SLC2A2 polymorphisms associated with type 2 diabetes risk, with rs5393 (AA genotype) increasing risk by threefold (odds ratio 3.04, 95% CI 1.34–6.88) . For porcine models:

  • Conduct comparative genomic analysis of the pig SLC2A2 locus to identify equivalent positions to human risk variants

  • Consider rs8192675, which has been associated with metformin response in humans

  • Generate recombinant proteins with equivalent mutations to assess functional impact

  • Develop pig lines with these polymorphisms to assess metabolic phenotypes

The human intronic variant rs8192675 in SLC2A2 has been associated with glycemic response to metformin, with a beta coefficient of 0.21% (P = 2.3×10−9) . Comparable variants could be explored in porcine models to study differential drug responses.

How can multi-gene expression systems be optimized for studying SLC2A2 in concert with other glucose metabolism proteins?

The 2A peptide approach offers significant advantages for multi-gene expression:

  • Construct design should place SLC2A2 in an optimal position within the polycistronic cassette

  • Consider using the 2A-based double-promoter expression strategy, which has shown high efficiency in porcine cells

  • For more than two genes, the pZCpTG vector design (as described in the literature) has demonstrated effectiveness in porcine cells and embryos

  • Monitor expression levels of all proteins to ensure balanced stoichiometry

Research has shown that while the 2A peptide was highly efficient for bicistronic expression in primary porcine cells, efficiency decreased for downstream genes in polycistronic constructs . Therefore, the double-promoter approach is recommended for expressing more than two proteins.

What are the common pitfalls in detecting recombinant pig SLC2A2 expression and how can they be addressed?

Several challenges can arise when working with recombinant pig SLC2A2:

ChallengePotential Solution
Poor antibody cross-reactivityDevelop pig-specific antibodies or use epitope tags
Low membrane expressionOptimize culture conditions; consider lower expression temperatures
Protein aggregationScreen multiple detergents for extraction; use GFP fusion to monitor aggregation
Rapid protein degradationInclude protease inhibitors; use pulse-chase experiments to determine half-life
Variable glycosylationAnalyze glycosylation pattern; consider using tunicamycin to assess importance

Researchers studying porcine tissues have reported difficulties finding antibodies that cross-react with porcine SLC2A2, SLC2A3, or SLC2A4 proteins , highlighting the importance of antibody validation or alternative detection strategies.

How can researchers resolve contradictory results between in vitro transport assays and cellular studies?

When faced with discrepancies between different experimental approaches:

  • Verify protein localization: Confirm membrane expression using multiple techniques

  • Assess post-translational modifications: Compare glycosylation patterns with native protein

  • Consider transport environment: pH, membrane composition, and temperature affect transport activity

  • Examine expression systems: Different cell types may provide different supporting proteins

  • Evaluate transport measurement techniques: Direct comparison of radioisotope versus fluorescent substrate assays

Each approach has limitations - for example, studies in Xenopus oocytes have shown that variants like p.V197I maintain normal membrane expression while retaining approximately 8% transport activity . This partial activity might be detected in some assays but not others, depending on sensitivity.

How can recombinant pig SLC2A2 be used to study reproductive biology and placental glucose transport?

Pig SLC2A2 shows distinctive expression patterns in reproductive tissues:

  • Design fluorescently tagged recombinant SLC2A2 for real-time imaging in placental explants

  • Develop transport assays specific to trophectoderm cells where SLC2A2 is expressed starting at day 15 of conceptus development

  • Create co-culture systems with endometrial and trophoblast cells to study directional glucose transport

  • Investigate steroid hormone regulation of SLC2A2 expression, as studies have shown that estrogen (E2) and progesterone (P4) do not affect SLC2A2 expression in uteri of pseudopregnant gilts

In pigs, SLC2A2 mRNA increases in endometria between days 25 and 60 of pregnancy and in placenta between days 30 and 85 , suggesting an important role in pregnancy that could be explored using recombinant protein.

What are the considerations for designing experiments to study the interaction between recombinant pig SLC2A2 and pharmaceutical compounds?

When studying drug interactions:

  • Establish baseline transport kinetics (Km, Vmax) for recombinant wild-type SLC2A2

  • Use site-directed mutagenesis to create variants corresponding to human polymorphisms known to affect drug responses, such as rs8192675

  • Design competition assays to identify compounds that may inhibit or enhance glucose transport

  • Consider the influence of membrane composition on drug binding and transport modulation

  • Incorporate molecular modeling to predict binding sites for potential therapeutics

Human studies have shown that the SLC2A2 intronic variant rs8192675 is associated with glycemic response to metformin . Creating equivalent porcine variants could help understand species-specific differences in drug responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.