Recombinant Pig Spastin (SPAST)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
SPAST; SPG4; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-613
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
SPAST
Target Protein Sequence
PGGRGKKKGSGGPSSPVPPRPPPPCLASSRPAPRPAPPPQSPHKRNLYYFSYPLFLGFAL
LRLVAFHLGLLFVWLCQRFSRALMAAKRSSRAAPAPASASPPAPVPGGEVERVRAFHKQA
FEYISVALRIDEDEKVGQKEQAVEWYKKGIEELEKGIAVVVTGQGEQCERARRLQAKMMT
NLVMAKDRLQLLEKLQPVLQFSKSQMDVYNDSTNLTCRNGHLQSESGAVPKRKDPLTHPS
NSLPRSKAIMKTGSTGLSGHHRAPSCSGLSIVSGMRQGPGPTTATHKSTPKTNRTNKPST
PTTAPRKKKDLKNFRNVDSNLANFIMNEIVDNGTAVKFDDIAGQELAKQALQEIVILPSL
RPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLV
RALFAVARELQPSIIFIDEVDSLLRERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVM
GATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARLTDG
YSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEA
YIRWNKDFGDTTV
Uniprot No.
Target Background
Function
Recombinant Pig Spastin (SPAST) is an ATP-dependent microtubule-severing protein. It specifically targets and severs polyglutamylated microtubules, exhibiting a preference for those with short polyglutamate tails. Severing activity is enhanced with increasing glutamate numbers (one to eight per tubulin), decreasing beyond this threshold. Activity is independent of tubulin acetylation or detyrosination. Microtubule severing facilitates reorganization of microtubule arrays and centrosomal microtubule release post-nucleation. SPAST is crucial for biogenesis and maintenance of complex microtubule networks in axons, spindles, and cilia. It plays a role in cytokinesis abscission and nuclear envelope reassembly during anaphase, cooperating with the ESCRT-III complex. Localized at the midbody (likely via IST1), it participates in membrane fission during abscission with the ESCRT-III complex. IST1-mediated recruitment to the nuclear membrane facilitates microtubule severing, promoting nuclear envelope sealing and mitotic spindle disassembly in late anaphase. SPAST is also involved in ER-to-Golgi membrane traffic and endosome recycling. IST1 recruits it to endosomes where it regulates early endosomal tubulation and recycling through microtubule severing. It likely contributes to axon growth and branching.
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Endoplasmic reticulum. Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus. Cytoplasm, cytoskeleton, spindle. Cytoplasm.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
