Recombinant Pig Sterol regulatory element-binding protein 1 (SREBF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SREBF1; ADD1; SREBP1; Sterol regulatory element-binding protein 1; SREBP-1; Adipocyte determination and differentiation-dependent factor 1; Sterol regulatory element-binding transcription factor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MDEPPFTEAALEQALAEPCELDAALLTDIEDMLQLINNQDSDFPGLFDAPYAGVAGGTDP TSPDASSPGSPTPPPSTMSSPLEGFLGGARTPPPPPVSPTQPAPTPLKMYPSVPAFSPGP GIKEEPVPLTILQPPTPQPLSGALLPQSLPALAPPQLSPAPVLGYPSPPGSFSSATPPGS TSQTLPGLPLASLPGVLPVSVHTQVQSAAPQQLLTATATPVVSPGTTTVTSQIQQVPVLL QPHFIKADSLLLTTMKTDMGTPVKAAGIGSLAPGTAVQAAPLQTLVSGGTILATVPLVVD TDKLPINRLAAGGKALSSGQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNK SAVLRKAIDYIRFLQQSNQKLKQENLSLRTAAHKSKSLKDLVSCSSGGRTDVPMEGVKPE VVDTLSPPPSDAGSPSQSSPLSLGSRGSSSGGSGSDSEPDSPVFEDSQMKPEQLPAPHGR GMLDRSRLAL
Uniprot No.

Target Background

Function

Recombinant Pig Sterol Regulatory Element-Binding Protein 1 (SREBF1) is a precursor to the transcription factor form. This precursor is embedded in the endoplasmic reticulum membrane. Low sterol concentrations trigger processing, releasing the transcription factor form, which translocates to the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis. SREBF1 is a key transcription factor regulating the expression of genes involved in cholesterol biosynthesis and lipid homeostasis. It binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') and exhibits dual sequence specificity, binding to both an E-box motif (5'-ATCACGTGA-3') and SRE-1. It regulates promoters of genes involved in cholesterol biosynthesis and the low-density lipoprotein receptor (LDLR) pathway of sterol regulation.

Gene References Into Functions
  1. In vivo studies using transgenic mice demonstrated that increased lncHR1 expression resulted in decreased hepatic expression of SREBP-1c, FAS, and Acetyl-CoA carboxylase alpha (ACCα), leading to reduced hepatic and plasma triglycerides after a high-fat diet. PMID: 28367099
  2. Polymorphisms in the ACACA and SREBF1 genes show promise as markers for pig carcass and performance traits. PMID: 23657179
  3. Associative analysis revealed a correlation between ADD1 gene polymorphisms and intramuscular fat content (IMF) and back fat thickness (BF). PMID: 16520310
  4. SREBF1 appears to play a significant role in regulating muscle fat deposition during postnatal pig growth. PMID: 17878274
Database Links

KEGG: ssc:397308

UniGene: Ssc.15992

Protein Families
SREBP family
Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.

Q&A

What are the key isoforms of SREBF1 in pigs and how do they differ?

The porcine SREBF1 gene produces two main isoforms through alternative splicing of the first exon: SREBP1a and SREBP1c. These isoforms differ in their N-terminal regions and exhibit distinct expression patterns and functional properties. While both isoforms regulate lipid metabolism, SREBP1c appears to be the predominant form expressed in porcine adipose tissues, similar to findings in humans. Research indicates that SREBP1c has greater expression in different adipose tissue depots compared to SREBP1a in pigs, suggesting tissue-specific regulatory mechanisms .

How does SREBF1 expression change during pig development?

SREBF1 exhibits a distinct developmental expression pattern in growing pigs. Studies have shown that porcine SREBF1 mRNA is present at very low concentrations at birth (only about 5.49% of the levels observed at 90 kg live weight) and progressively increases throughout postnatal development. The relative quantity of SREBF1 mRNA (measured as SREBF1/ACTB ratio) steadily rises to reach its highest value at 90 kg live weight . This developmental pattern suggests that SREBF1 expression correlates with increased fat deposition during pig growth.

The following table illustrates the developmental pattern of SREBF1 expression relative to adipose tissue development:

Body weight (kg)Subcutaneous adipose (kg)Ventral adipose (kg)Mesentery adipose (kg)Fat deposition rate (%)SREBF1/ACTB ratio
10.031LowLowLow0.05
30IncreasedIncreasedIncreasedIncreased0.19
50Further increasedFurther increasedFurther increasedFurther increased0.36
70Further increasedFurther increasedFurther increasedFurther increased0.55
90HighestHighestHighestHighest0.91

Data adapted from developmental pattern study showing progressive increase in SREBF1 expression correlating with fat deposition .

What is the relationship between SREBF1 expression and fat deposition in pigs?

Analysis of SREBF1 expression in relation to adipose deposition shows a strong positive correlation between SREBF1 mRNA levels and fat deposition rates in growing pigs (r = 0.89, P < 0.05) . As pigs grow from 1 kg to 90 kg live weight, both SREBF1 expression and fat deposition increase significantly. This correlation suggests that SREBF1 plays a crucial regulatory role in adipogenesis and fat accumulation during pig development. The relationship is especially pronounced in subcutaneous adipose tissue, where SREBF1 expression increases in parallel with tissue expansion through the growing phases.

How does deletion of specific SREBF1 isoforms affect adipogenesis in porcine mesenchymal stem cells?

Targeted deletion of the SREBF1c isoform using CRISPR/Cas9 technology has revealed its essential role in porcine adipogenesis. Studies utilizing mesenchymal stem cells derived from adipose tissue (AD-MSC) with a targeted deletion in the 5'-regulatory region specific to the SREBF1c isoform (while preserving SREBF1a) demonstrate that SREBF1c is critical for proper adipocyte differentiation .

In SREBF1c-deleted cells, adipogenesis is blocked as evidenced by:

  • Failure of lipid droplet accumulation (measured by BODIPY staining)

  • Dysregulation of key adipogenic genes, including:

    • Decreased expression of PPARγ and FABP4

    • Reduced expression of CEBPA and CEBPD

    • Increased expression of CEBPB

    • Minimal changes in GATA2 expression

These findings suggest that SREBF1c acts upstream in the adipogenic cascade, with its deletion disrupting the entire differentiation program. The mechanism likely involves SREBF1c's role in producing lipid-derived ligands for PPARγ activation, which is a central regulator of adipogenesis .

What is the temporal expression pattern of SREBF1 and related genes during porcine adipogenesis?

The expression of SREBF1 and other adipogenic genes follows a specific temporal pattern during porcine adipocyte differentiation. The table below summarizes the expression changes observed in wild-type and SREBF1c-deleted (DEL) adipose-derived mesenchymal stem cells during 10 days of differentiation:

Gene/MarkerDay 0Day 2Day 4Day 6Day 8Day 10
BODIPY-
SREBF1a===
SREBF1c
GATA2=====
CEBPD==
CEBPB=
CEBPA=
PPARG
FABP4===

Key: ↓ decreased, ↑ increased, = unchanged expression in SREBF1c-deleted cells compared to wild-type .

This temporal pattern reveals the complex regulatory network involved in adipogenesis, where SREBF1c deletion disrupts the normal expression of both upstream and downstream factors in the differentiation cascade.

How does the tissue-specific expression of SREBF1 isoforms in pigs compare to other mammalian models?

The expression pattern of SREBF1 isoforms shows species-specific differences that are important for interpreting research findings across models. In pigs, SREBF1c is the predominant isoform expressed in adipose tissues, which aligns with observations in humans but differs from some rodent models .

This contrasts with findings in certain human cell lines like Simpson–Golabi–Behmel syndrome (SGBS) preadipocytes, where SREBP1a is the predominant isoform and SREBP1c is expressed at lower levels . In rodents, lipogenesis is regulated in both liver and adipose tissue, while in non-rodent mammals like pigs, adipose tissue is the primary lipogenic organ active in this process .

These differences highlight the importance of selecting appropriate model systems when studying SREBF1 function, particularly when translating findings to human applications. The pig model may offer advantages for certain aspects of human adipose biology research due to these similarities in isoform expression patterns.

What are effective approaches for generating SREBF1 isoform-specific knockouts in porcine adipose cells?

CRISPR/Cas9 gene editing has proven effective for generating isoform-specific knockouts of SREBF1 in porcine cell models. The methodology involves:

  • Design of guide RNAs: Target sequences specific to regulatory regions of the SREBF1c isoform while avoiding regions that would disrupt SREBF1a.

  • Delivery system: Typically utilizing plasmid-based or ribonucleoprotein (RNP) delivery into mesenchymal stem cells derived from adipose tissue.

  • Screening approach:

    • PCR amplification of the targeted region

    • Sequencing to confirm the presence and nature of the deletion

    • RT-PCR to verify isoform-specific effects on transcription

  • Validation methods:

    • Quantitative RT-PCR to measure expression levels of both isoforms

    • Western blotting to confirm protein-level changes

    • Functional assays to assess adipogenic capacity

This approach has successfully generated adipose-derived mesenchymal stem cells with specific deletion of the SREBF1c isoform by targeting the 5'-regulatory region specific to this variant while preserving SREBF1a expression . Such models are valuable for dissecting the distinct roles of SREBF1 isoforms in porcine adipogenesis.

What techniques are recommended for analyzing SREBF1 binding to chromatin in porcine cells?

Chromatin immunoprecipitation (ChIP) followed by sequencing (ChIP-seq) or PCR represents the gold standard for analyzing SREBF1 chromatin binding. Based on approaches used in other mammalian systems, the following methodology can be adapted for porcine cells:

  • Antibody selection: Use isoform-specific antibodies to distinguish between SREBF1a and SREBF1c binding patterns. The antibody should be validated for specificity and efficiency in ChIP applications.

  • Experimental conditions: Compare different physiological states to identify condition-specific binding patterns. For SREBF1, comparing fasted, control, and refed conditions can reveal dynamic regulatory patterns, as demonstrated in mouse models .

  • Sequencing analysis parameters:

    • Set appropriate minimum sequence read thresholds (e.g., 8 reads)

    • Establish minimum read ratio comparing specific antibody with IgG control (e.g., 5-fold enrichment)

    • Use stringent cutoffs to ensure high specificity

  • Binding motif analysis:

    • Search for canonical SRE (Sterol Regulatory Element) motifs

    • Identify novel binding motifs that may be species-specific

    • Look for co-occurring transcription factor binding sites within 150bp of SREBF1 peaks, such as Sp1 binding sites, which are present near approximately 50% of SREBF1 binding sites in other mammals

  • Functional validation: Confirm binding site functionality through reporter assays and mutational analyses of identified motifs.

This comprehensive approach can reveal the genomic landscape of SREBF1 binding in porcine cells and identify target genes and regulatory mechanisms specific to pig adipose biology.

How can researchers effectively measure the relationship between SREBF1 expression and adipogenesis in pig models?

To effectively measure the relationship between SREBF1 expression and adipogenesis in pig models, researchers should implement a multi-faceted approach:

  • Developmental analysis:

    • Study animals at multiple growth stages (e.g., 1kg, 30kg, 50kg, 70kg, 90kg live weights)

    • Use consistent sampling protocols across developmental stages

    • Consider both sexes to account for potential sex-specific differences

  • Gene expression quantification:

    • Use RT-PCR with isoform-specific primers to distinguish SREBF1a and SREBF1c

    • Normalize expression to stable reference genes (e.g., ACTB)

    • Consider using digital PCR or RNA-seq for more precise quantification

  • Adipose tissue analysis:

    • Measure multiple adipose depots (subcutaneous, ventral, mesenteric)

    • Calculate fat deposition rates as percentage of body weight

    • Apply histological techniques to assess adipocyte size and number

  • Correlation analysis:

    • Perform statistical analysis to determine correlation coefficients between SREBF1 expression and fat deposition parameters

    • Use multivariate analysis to account for confounding factors

    • Consider time-series analysis to capture dynamic relationships

  • In vitro validation:

    • Establish primary adipocyte cultures from the same animals

    • Monitor differentiation through lipid accumulation (Oil Red O or BODIPY staining)

    • Manipulate SREBF1 expression through overexpression or knockdown approaches

This comprehensive approach has successfully demonstrated a strong positive correlation (r = 0.89, P < 0.05) between SREBF1 expression and fat deposition rates in growing pigs , providing a robust framework for further investigations.

How should researchers interpret conflicting data on SREBF1 function between different model systems?

When encountering conflicting data on SREBF1 function across different model systems, researchers should consider:

  • Species-specific variations: SREBF1 functions differently between rodents, pigs, and humans. For instance, in rodents, lipogenesis is regulated in both liver and adipose tissue, while in non-rodent mammals like pigs, adipose tissue is the primary lipogenic organ . This fundamental difference affects how SREBF1 function should be interpreted across species.

  • Isoform predominance: The relative expression of SREBF1a versus SREBF1c varies across systems. In human SGBS preadipocytes, SREBP1a is the predominant isoform, while in porcine adipose tissue, SREBP1c predominates . These differences may explain seemingly contradictory functional results.

  • Developmental context: SREBF1 expression and function change dramatically during development. In pigs, SREBF1 mRNA is barely detectable at birth but increases steadily through growth . Conflicting results may arise from comparing different developmental stages.

  • Methodological differences: Consider variations in:

    • Knockout/knockdown approaches (complete vs. isoform-specific)

    • In vivo versus in vitro systems

    • Primary cells versus immortalized cell lines

  • Integrated data approach: Synthesize findings across multiple experimental systems to identify:

    • Conserved core functions

    • Species-specific adaptations

    • Context-dependent regulatory mechanisms

By carefully considering these factors, researchers can reconcile apparently conflicting data and develop more nuanced models of SREBF1 function that account for biological complexity and experimental context.

What statistical approaches are most appropriate for analyzing SREBF1 expression data across developmental stages?

For analyzing SREBF1 expression data across developmental stages in pigs, the following statistical approaches are recommended:

  • Descriptive statistics:

    • Calculate means and standard deviations for each developmental stage

    • Generate visualizations showing trends over time

    • Normalize expression data to appropriate reference genes

  • Inferential statistics:

    • Use ANOVA with post-hoc tests to compare expression across multiple developmental stages

    • Apply appropriate corrections for multiple comparisons (e.g., Bonferroni, Tukey's HSD)

    • Consider non-parametric alternatives if data do not meet normality assumptions

  • Correlation analysis:

    • Calculate Pearson's or Spearman's correlation coefficients between SREBF1 expression and:

      • Fat deposition parameters

      • Expression of other adipogenic genes

      • Growth parameters

    • Test significance of correlations and report p-values

  • Regression modeling:

    • Develop linear or non-linear regression models to predict fat deposition based on SREBF1 expression

    • Consider multiple regression to account for additional variables

    • Evaluate model fit using R² and other goodness-of-fit measures

  • Time-series analysis:

    • Apply repeated measures designs when following the same animals longitudinally

    • Consider growth curve modeling for developmental data

    • Use mixed models to account for random effects (e.g., litter, family)

These approaches have successfully identified significant correlations between SREBF1 expression and fat deposition in pigs (r = 0.89, P < 0.05) , providing a statistical framework for developmental studies of SREBF1 function.

What are the most promising future research directions for recombinant pig SREBF1 studies?

Based on current knowledge, the most promising future research directions for recombinant pig SREBF1 studies include:

  • Isoform-specific functional genomics: Expanding CRISPR/Cas9 approaches to create more refined isoform-specific modifications that can precisely delineate the distinct roles of SREBF1a and SREBF1c in different porcine tissues.

  • Chromatin landscape mapping: Comprehensive ChIP-seq analysis of SREBF1 binding patterns in different porcine tissues and developmental stages to identify tissue-specific regulatory networks and binding motifs.

  • Metabolic integration: Investigation of how SREBF1 integrates with other metabolic pathways in pigs, particularly the interplay between adipogenesis and muscle development, which has implications for meat quality.

  • Translational research: Leveraging similarities between porcine and human SREBF1 biology to develop potential therapeutic approaches for metabolic disorders related to lipid metabolism.

  • Breed-specific differences: Examining how SREBF1 expression and function vary between different pig breeds with distinct fat deposition characteristics, providing insights into genetic selection for optimal meat production.

  • Environmental influences: Studying how dietary factors and environmental conditions modify SREBF1 activity in pigs, particularly how different feeding regimens affect expression patterns.

  • Single-cell approaches: Applying single-cell transcriptomics and epigenomics to understand the heterogeneity of SREBF1 expression and function across different cell populations within adipose tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.