Recombinant Pig Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Succinate Dehydrogenase Cytochrome b560 Subunit, Mitochondrial (SDHC)

Recombinant Pig Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC) refers to a specific form of the SDHC protein produced using recombinant DNA technology . SDHC is a vital subunit of the succinate dehydrogenase (SDH) complex, also known as Complex II of the mitochondrial electron transport chain . This complex plays a crucial role in both the citric acid cycle and aerobic respiration within mitochondria . The SDHC protein, along with SDHD, anchors the catalytic core subunits (SDHA and SDHB) to the inner mitochondrial membrane .

Structure and Function

SDHC is one of the four nuclear-encoded subunits that constitute the succinate dehydrogenase complex . It functions as an integral membrane protein, forming a dimer with SDHD, which is essential for anchoring Complex II to the inner mitochondrial membrane . This SDHC/SDHD dimer provides the necessary binding sites for ubiquinone and water, which are critical components during electron transport within Complex II .

The process begins when SDHA oxidizes succinate, leading to the formation of FADH~2~ and fumarate . The electrons generated from succinate then travel along the iron-sulfur (Fe-S) relay in the SDHB subunit, ultimately reaching the [3Fe-4S] iron-sulfur cluster . These electrons are subsequently transferred to ubiquinone at the Q pool active site located in the SDHC/SDHD dimer . Hydrogen bond interactions with Tyr83 of SDHD orient the O1 carbonyl oxygen of ubiquinone at the active site . The presence of electrons in the [3Fe-4S] iron-sulfur cluster causes ubiquinone to shift into a second orientation, facilitating another hydrogen bond interaction between the O4 carbonyl group of ubiquinone and Ser27 of SDHC . After the first single-electron reduction, a semiquinone radical species is formed, and the arrival of a second electron from the [3Fe-4S] cluster completes the reduction of ubiquinone to ubiquinol .

Gene Information

The SDHC gene encodes the SDHC protein, and mutations in this gene have been linked to the development of pheochromocytomas and paragangliomas . Alternative splicing of SDHC transcripts results in different variants . These alternative splicing variants (ASVs) can have a dominant-negative effect on SDHC activity and are associated with human diseases . For example, the Δ3 ASV lacks exon 3, affecting the MCII oxidoreductase activity, while the Δ5 ASV lacks the heme-binding domain due to a frameshift mutation, leading to a significant reduction in SDH complex activity .

Role in Cellular Processes and Tumorigenesis

Research indicates that reactive oxygen species (ROS) produced due to mitochondrial damage in SDHC can trigger tumor progression . Specifically, SDHC affects hypoxia-inducible factor 1α (HIF-1α) stabilization and nuclear translocation under normal oxygen conditions, leading to the activation of genes that promote tumor growth .

SDHC and SDHIs

Succinate dehydrogenase inhibitors (SDHIs) are used globally to prevent mold proliferation on plants and plant products . SDHIs block SDH activity in various species, with varying degrees of effectiveness . The sensitivity of human SDH to different SDHIs varies, with last-generation SDHIs like penflufen, isopyrazam, and bixafen showing significant inhibitory effects .

Table 1. Comparative Inhibitory Effects (IC50 Values) of Eight SDHIs on the RC Activities of 4 Different Species

Homo sapiensLumbricus terrestrisApis melliferaBotrytis cinerea
FlutolanilSCCR: 18.7±3.5 μMSCCR: 0.36±0.02 μMSCCR: 0.8±0.5 μMSCCR: 8.6±4.5 μM
FluopyramSCCR 160±40 μMSCCR 30.6±7.6 μMSCCR 3.8±0.3 μMSCCR 0.2±0.1 μM
BoscalidSCCR 4.8±0.2 μMSCCR 0.5±0.3 μMSCCR 76.7±6.0 μMSCCR 0.8±1.1 μM
FluxapyroxadSCCR 2.1±0.7 μMSCCR 0.71±0.07 μMSCCR 11.7±3.4 μMSCCR 0.095±0.008 μM
PenflufenSCCR 1.3±0.3 μMSCCR 1.13±0.16 μMSCCR 7.5±0.7 μMSCCR 0.13±0.06 μM
PenthiopyradSCCR 3.7±1.1 μMSCCR 0.70±0.01 μMSCCR 10±2 μMSCCR 0.045±0.023 μM
IsopyrazamSCCR 0.63±0.18 μMSCCR 0.46±0.17 μMSCCR 5.1±2.3 μMSCCR 0.023±0.004 μM
BixafenSCCR 0.34±0.12 μMSCCR 6.0±3.6 μMSCCR 3.3±0.33 μMSCCR 0.07±0.06 μM

SCCR = succinate cytochrome c reductase

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDHC; Succinate dehydrogenase cytochrome b560 subunit, mitochondrial; Succinate-ubiquinone oxidoreductase cytochrome B large subunit; CYBL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-169
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
LGTTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSA LLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLT QSGVVVLILTVLSSVGLAAM
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. SDHC facilitates electron transfer from succinate to ubiquinone (coenzyme Q).

Database Links
Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in heart muscle (at protein level).

Q&A

What is SDHC and what is its role in mitochondrial function?

SDHC (Succinate Dehydrogenase Cytochrome b560 Subunit, Mitochondrial) is a critical component of the mitochondrial succinate-ubiquinone reductase complex. This complex consists of two main parts: a water-soluble succinate dehydrogenase and a two-polypeptide membrane-anchoring protein fraction known as QPs. SDHC is specifically associated with the larger polypeptide of QPs, referred to as QPs1 or cytochrome b560 . It functions primarily as a transmembrane protein that anchors the catalytic components of the succinate dehydrogenase complex to the inner mitochondrial membrane. This anchoring is essential for the electron transport process in the respiratory chain, facilitating the conversion of succinate to fumarate while reducing ubiquinone to ubiquinol. The succinate dehydrogenase complex plays a crucial role in both the tricarboxylic acid cycle and the electron transport chain, making SDHC essential for cellular energy production.

How does SDHC interact with other SDH subunits?

SDHC interacts with multiple subunits of the succinate dehydrogenase complex (SDHA, SDHB, and SDHD) to form a functional enzyme. Immunochemistry studies have demonstrated that antibodies against QPs1 (SDHC) inhibited 75% of the reconstitutive activity of QPs and reacted with both submitochondrial particles (SMP) and mitoplasts . Notably, the binding of these antibodies to SMP increased significantly when succinate dehydrogenase was removed by alkaline treatment, indicating that SDHC is a transmembranous protein with specific epitopes covered by succinate dehydrogenase . This finding reveals that SDHC has direct physical contact with other SDH subunits, particularly SDHA and SDHB components. The interactions between these subunits are essential for the assembly and stability of the complete SDH complex, which is crucial for mitochondrial energy production. Disruption of these interactions through mutations or other mechanisms can impair SDH activity and potentially lead to metabolic disorders.

What are the structural characteristics of pig SDHC?

The pig SDHC protein has been studied through computational modeling approaches that map the human SDH model onto its homologous pig counterpart . Structural analysis shows that SDHC contains specific transmembrane domains that anchor the protein in the inner mitochondrial membrane. When examining the assembled SDH complex, tools such as 'Dictionary Of Protein Secondary Structure' (DSSP) are employed to compute the solvent accessibility for specific residues, helping researchers understand structural features . The recombinant pig SDHC protein is often expressed in yeast systems, reaching >90% purity and showing suitability for analytical techniques like SDS-PAGE . Interestingly, the recombinant protein migrates as 43 kDa in SDS-PAGE, which differs from the theoretical molecular weight due to glycosylation . This post-translational modification likely plays a role in the protein's structural integrity and function. Schematic diagrams of protein interactions within the SDH complex can be computed with tools like 'LIGPLOT,' allowing researchers to compare the arrangement of the local environment in wild-type versus mutated proteins .

What are the recommended methods for expressing and purifying recombinant pig SDHC?

Expression of recombinant pig SDHC typically employs yeast expression systems, which provide appropriate post-translational modifications required for proper protein folding and function . When designing expression constructs, researchers should consider adding affinity tags (such as His-tags) to facilitate purification . The purification process generally involves these key steps:

  • Cell lysis under conditions that maintain protein stability

  • Initial clarification of lysate by centrifugation

  • Affinity chromatography using the His-tag or other affinity tags

  • Additional purification steps such as ion-exchange or size-exclusion chromatography

  • Quality assessment using SDS-PAGE and other analytical methods

It's important to note that recombinant pig SDHC may migrate differently than expected in SDS-PAGE (approximately 43 kDa) due to glycosylation . This should be considered when assessing purification results. Additionally, as a membrane protein, SDHC requires appropriate detergents or lipid environments during purification to maintain its native conformation and prevent aggregation. The final purified protein should be assessed not only for purity but also for proper folding and functional activity through appropriate biochemical assays.

How can researchers verify the activity and integrity of recombinant SDHC?

Verifying recombinant SDHC activity and integrity requires multiple complementary approaches:

Table 1: Methods for Verifying Recombinant SDHC Activity and Integrity

MethodProcedureInformation GainedLimitations
SDS-PAGEElectrophoretic separation followed by stainingPurity, approximate molecular weightMay show different migration (43 kDa) due to glycosylation
Western blottingTransfer to membrane and detection with specific antibodiesProtein identity confirmationRequires specific antibodies
Reconstitution assaysCombining with other SDH subunitsFunctional activity assessmentComplex to interpret
Spectroscopic analysisUV-visible and fluorescence spectroscopyCofactor binding and structural integrityLimited structural information
In vitro electron transferMonitoring reduction of artificial electron acceptorsFunctional electron transfer capabilityMay not reflect physiological activity

Researchers should implement at least two complementary methods to ensure reliable verification of their recombinant SDHC preparation. For functional assessment, antibodies against QPs1 (SDHC) can be particularly useful, as they have been shown to inhibit 75% of the reconstitutive activity of QPs , providing a quantitative measure of functional integrity.

What challenges are associated with studying mutations in SDHC?

Studying mutations in SDHC presents several methodological challenges that researchers must address:

Second, understanding the structural impact of mutations requires mapping them onto the 3D structure of the protein. Researchers have successfully modeled human SDH using its homologous pig counterpart as a template . When analyzing mutations, it's crucial to calculate their distance from functional sites (such as the FAD binding site) and assess their solvent accessibility both in the assembled complex and in the isolated subunit .

Third, splicing site mutations require specialized analysis approaches. For instance, a deletion c.457-3_457-1 delCAG located immediately upstream of an exon was analyzed with two different splicing site predictors, both indicating an alternative splicing site that would lead to a frame shift and premature stop codon . This demonstrates the importance of using multiple prediction tools for accurate analysis.

Finally, functional validation of mutations requires reconstitution of the complete SDH complex, which is technically challenging due to the membrane-bound nature of SDHC and the complex interactions between subunits.

How can recombinant pig SDHC be used in transgenic animal studies?

Recombinant pig SDHC can be incorporated into transgenic animal research through several sophisticated approaches:

Transgenic pig models represent a valuable system for studying SDHC function in vivo. The development of reporter transgenic pigs, as demonstrated for monitoring Cre recombinase activity, provides a blueprint for creating SDHC-focused transgenic animals . These models allow researchers to monitor gene expression patterns and study protein function in a physiologically relevant context. The generation of such models involves creating a single vector that drives the expression of a reporter protein (such as EGFP) after Cre-mediated excision of loxP-flanked stop sequences .

For SDHC-specific studies, researchers can design conditional gene modifications using the Cre recombinase-loxP system. This approach allows for tissue-specific or temporally controlled alterations in SDHC expression, enabling the study of its function in specific cellular contexts. The reporter transgenic pig methodology would be particularly valuable for monitoring these conditional modifications, as it provides visual confirmation of Cre recombinase activity in vivo .

Additionally, transgenic pig models could be used to express specific SDHC mutations identified in human diseases, creating valuable models for understanding pathophysiological mechanisms. The pig is considered an excellent model for human diseases due to its physiological similarities to humans , making it particularly suitable for studying mitochondrial disorders involving SDHC.

What is the relationship between SDHC structure and function in the context of mitochondrial disease?

The relationship between SDHC structure and function is critical for understanding mitochondrial diseases. SDHC functions as part of the succinate-ubiquinone reductase complex, with specific structural features that determine its proper function.

Studies using computational modeling have shown that mutations in SDHC, even when located far from the protein active site, can disrupt protein folding, subunit assembly, or stability . This is particularly important when considering the transmembrane nature of SDHC, which was confirmed by antibody binding studies showing increased accessibility of epitopes when succinate dehydrogenase was removed from submitochondrial particles .

When analyzing structural impacts, researchers calculate the distance between mutated positions and functional sites such as the flavine adenine dinucleotide (FAD) binding site . Additionally, solvent accessibility calculations performed for both the assembled SDH complex and the single subunit provide insights into how mutations might affect protein-protein interactions or stability .

The membrane-anchoring function of SDHC is critical for the proper assembly and function of the entire SDH complex. As part of QPs, SDHC provides essential structural support for the catalytic components. Antibodies against QPs1 (SDHC) inhibited 75% of the reconstitutive activity of QPs, highlighting the protein's importance in complex formation and function .

What methodological approaches can resolve contradictions in SDHC experimental data?

When faced with contradictory results in SDHC research, researchers should employ several methodological approaches to resolve these discrepancies:

First, validate protein identity and integrity using multiple techniques. As demonstrated in stack exchange discussions about contradictory data, seemingly identical samples can yield different results when analyzed at different levels . For SDHC, this means verifying both the primary sequence and post-translational modifications, particularly glycosylation which affects migration in SDS-PAGE (causing it to appear as 43 kDa rather than predicted weight) .

Second, standardize experimental conditions across laboratories. Minor variations in buffer composition, temperature, or sample preparation can significantly affect results, especially for membrane proteins like SDHC. When comparing data from different sources, these experimental variables must be considered and controlled.

Fourth, use appropriate statistical analyses to distinguish meaningful differences from experimental variation. This is particularly important when analyzing the effects of mutations or post-translational modifications on SDHC function.

Finally, consider biological context. SDHC functions as part of a complex in a specific membrane environment, so isolated protein studies may yield different results compared to studies in intact mitochondria or cells. Reconciling these differences requires understanding the biological context of each experimental system.

How can solubility issues with recombinant SDHC be addressed?

Solubility challenges are common when working with recombinant SDHC due to its transmembrane nature. Several evidence-based approaches can address these issues:

Table 2: Strategies for Improving Recombinant SDHC Solubility

Researchers should systematically evaluate these approaches, beginning with detergent screening and buffer optimization as these are relatively straightforward to implement. Importantly, any solubility-enhancing strategy must be validated to ensure it doesn't compromise the protein's functional integrity.

The evidence from recombinant pig P-cadherin studies suggests that successful expression in yeast systems can achieve >90% purity with appropriate solubility for SDS-PAGE analysis , indicating that careful optimization of expression and purification conditions can overcome solubility challenges.

What approaches can resolve activity inconsistencies between recombinant and native SDHC?

When recombinant SDHC shows different activity patterns compared to native SDHC, researchers should consider several methodological approaches to investigate and resolve these discrepancies:

First, examine post-translational modifications. Recombinant pig SDHC expressed in yeast exhibits glycosylation that affects its migration in SDS-PAGE (appearing at 43 kDa) . Different expression systems may produce varying glycosylation patterns or miss other modifications present in native SDHC, potentially affecting activity. Mass spectrometry analysis can identify these modifications and guide expression system selection.

Second, assess protein folding and structural integrity. Native SDHC functions within the mitochondrial membrane in complex with other subunits. Antibody binding studies have shown that SDHC epitopes are partially covered by succinate dehydrogenase in native systems , suggesting that proper complex formation is essential for native conformation. Circular dichroism spectroscopy and limited proteolysis can help evaluate structural differences between recombinant and native proteins.

Third, consider reconstitution conditions. For accurate activity comparison, recombinant SDHC should be reconstituted with other SDH subunits under conditions that mimic the native environment. Immunochemistry studies showed that antibodies against QPs1 (SDHC) inhibited 75% of reconstitutive activity , indicating that proper complex assembly significantly affects function.

Fourth, validate activity assays using multiple methods. Different assay conditions may favor either recombinant or native protein activity. Using multiple complementary assays provides a more complete picture of functional integrity.

Finally, examine sequence differences between recombinant and native proteins, including any remaining tag sequences or mutations introduced during cloning. Even minor sequence differences can affect activity, particularly for proteins involved in electron transfer.

How can researchers distinguish between SDH subunit-specific effects in experimental systems?

Distinguishing between effects specific to SDHC versus other SDH subunits requires sophisticated experimental design:

First, employ subunit-specific antibodies for immunodepletion or immunoprecipitation studies. Research has shown that antibodies against QPs1 (SDHC) inhibited 75% of the reconstitutive activity of QPs and showed increased binding when succinate dehydrogenase was removed from submitochondrial particles . Similar approaches with antibodies specific to each subunit can help isolate subunit-specific effects.

Second, use reconstitution experiments with defined subunit compositions. By systematically varying which recombinant subunits are included in reconstitution assays, researchers can attribute specific functional aspects to individual subunits. This approach requires high-quality recombinant proteins with verified activity, such as recombinant pig SDHC with >90% purity .

Third, implement genetic approaches in model systems. Conditional knockout or knockdown of specific subunits, followed by rescue experiments with wild-type or mutant versions, can definitively link phenotypes to particular subunits. Transgenic pig models with reporter systems, similar to those developed for monitoring Cre recombinase activity , could be adapted for this purpose.

Fourth, employ structural biology approaches. Computational modeling of the SDH complex, as done when mapping human SDH onto its homologous pig counterpart , can predict subunit-specific contributions to complex structure and function. These predictions can then guide targeted experimental validation.

Finally, use biophysical techniques that can probe specific regions of the complex. For example, site-directed spin labeling combined with electron paramagnetic resonance spectroscopy can provide information about specific domains within the assembled complex.

What emerging technologies hold promise for advancing SDHC research?

Several cutting-edge technologies are poised to transform SDHC research in the coming years:

Cryo-electron microscopy (cryo-EM) offers unprecedented potential for resolving the structure of membrane protein complexes like SDH without the need for crystallization. This technique could provide detailed insights into the structural relationships between SDHC and other subunits, building upon existing computational modeling approaches that have mapped human SDH onto pig counterparts .

CRISPR-Cas9 gene editing in pig models represents another frontier. Building on the foundation of reporter transgenic pig technology used for monitoring Cre recombinase activity , researchers could create precise SDHC mutations to study their functional impact in a physiologically relevant model. Given that pigs are considered suitable models for human disease , such approaches could yield valuable insights into SDHC-related pathologies.

Proteomics approaches incorporating hydrogen-deuterium exchange mass spectrometry (HDX-MS) could reveal dynamic aspects of SDHC structure and interactions that are inaccessible to static structural methods. This would complement traditional immunochemistry studies that have identified SDHC as a transmembranous protein with epitopes covered by succinate dehydrogenase .

Organoid and microphysiological systems incorporating recombinant SDHC could bridge the gap between isolated protein studies and in vivo experiments. These systems would allow manipulation of SDHC in a tissue-like context, providing more translatable results than traditional cell culture.

Single-molecule techniques for studying membrane proteins are also emerging, offering potential for observing SDHC behavior and interactions at unprecedented resolution. These approaches could help explain why recombinant protein sometimes migrates differently than expected in SDS-PAGE (approximately 43 kDa) due to glycosylation .

How might recombinant pig SDHC contribute to understanding human mitochondrial diseases?

Recombinant pig SDHC offers significant potential for elucidating human mitochondrial disease mechanisms for several reasons:

The high sequence homology between pig and human SDHC makes pig models particularly valuable for studying human diseases. Computational modeling has already demonstrated the feasibility of mapping human SDH mutations onto pig homologs , allowing researchers to predict structural and functional consequences of disease-associated variants.

Recombinant pig SDHC can be used to create in vitro models of disease-associated mutations. By introducing specific mutations identified in human patients into recombinant pig SDHC, researchers can study their biochemical effects in controlled systems. This approach is particularly valuable for understanding how mutations located far from the protein active site can still disrupt function .

Transgenic pig models expressing human disease mutations would provide physiologically relevant systems for studying pathophysiology. Building on existing transgenic pig technologies , researchers could create pigs expressing SDHC mutations to study their effects on mitochondrial function and whole-organism physiology.

Drug screening platforms incorporating recombinant mutant SDHC could facilitate the development of targeted therapies. High-throughput screening using recombinant proteins with disease-associated mutations could identify compounds that restore proper protein folding, stability, or function.

Biochemical comparison of normal and mutant recombinant SDHC can reveal specific functional deficits associated with disease. For instance, studies have shown that antibodies against QPs1 (SDHC) inhibited 75% of reconstitutive activity , suggesting that similar approaches could quantify the impact of disease mutations on complex assembly and function.

What methodological advances are needed to improve recombinant SDHC expression and purification?

Despite significant progress in recombinant protein technology, several methodological challenges remain in SDHC research that require innovative solutions:

Table 3: Methodological Challenges and Potential Solutions for Recombinant SDHC Research

ChallengeCurrent LimitationsPotential InnovationsExpected Impact
Membrane protein expressionLow yields, improper foldingCell-free expression systems with defined membrane mimeticsHigher yield of properly folded protein
Post-translational modificationsExpression systems may not reproduce native modificationsEngineered yeast or mammalian cells with humanized glycosylationMore physiologically relevant modifications
Protein stabilityMembrane proteins often unstable when purifiedNanobody stabilization of native conformationsImproved structural integrity during purification
Functional reconstitutionComplex assembly challenging to reproduceCo-expression of complete complexes with membrane scaffoldsMore native-like complex formation
Structural analysisMembrane proteins challenging for structural studiesLipid cubic phase crystallization combined with cryo-EMHigher resolution structural information

The current evidence shows that recombinant pig SDHC can be expressed in yeast systems with >90% purity , but migration differences in SDS-PAGE (43 kDa) due to glycosylation highlight the importance of addressing post-translational modifications. Additionally, the observation that SDHC epitopes are covered by succinate dehydrogenase in native systems emphasizes the need for improved reconstitution approaches that better mimic the native environment.

Advanced computational methods for predicting optimal expression constructs could also improve success rates. Current approaches for modeling human SDH on pig counterparts could be extended to design expression constructs with improved stability and folding properties. These methodological advances would significantly enhance researchers' ability to study SDHC structure-function relationships and their implications for human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.