Recombinant Pig Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pig Suppressor of Tumorigenicity 7 Protein (ST7)

The ST7 gene encodes a protein believed to function as a tumor suppressor in humans . The precise function of ST7 is still under investigation, but research suggests it plays a role in modulating the tumor microenvironment . The ST7 gene is located on chromosome 7q31.1, a region frequently associated with tumor suppressor activity .

Role as a Tumor Suppressor

Multiple lines of evidence suggest that ST7 functions as a tumor suppressor gene (TSG) .

  • Inhibition of Tumor Growth: ST7 has been shown to suppress the growth of PC-3 prostate cancer cells in mice and increase the latency of tumor detection .

  • Suppression of Colony Formation: Re-expression of ST7 is associated with the suppression of colony formation in MDA-MB-231 breast cancer cells under anchorage-independent conditions .

  • Downregulation in Cancer: ST7 mRNA expression was found to be downregulated in 44% of primary breast cancers .

4.1. Studies in Colorectal, Gastric, and Hepatocellular Carcinomas

A study investigated the frequency of ST7 gene mutations in primary colorectal cancers, gastric cancers, and hepatocellular carcinomas . The study used PCR-SSCP analysis and direct DNA sequencing to survey mutations in the entire ST7 coding sequence . The researchers rarely detected mutations in the ST7 gene in these cancers, which aligns with findings from other groups .

ST7 in Other Organisms

Research on Streptococcus suis (S. suis) has identified Muramidase-released protein (MRP) in serotype 2 ST7 strains as a human fibrinogen-binding protein . MRP contributes to the development of meningitis and increases bacterial loads in the brain of mice .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Database Links

UniGene: Ssc.4370

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is porcine ST7 protein and what are its key structural characteristics?

Porcine Suppressor of Tumorigenicity 7 (ST7), also known as RAY1, TSG7, and FAM4A1, is a type I transmembrane protein belonging to the Low-Density Lipoprotein Receptor (LDLR) superfamily and is designated LRP12. The protein contains several key structural domains:

  • A signal sequence (approximately 32 amino acids)

  • An extracellular domain (ECD) of approximately 460 amino acids containing:

    • Two CUB domains

    • Five LDLR class A domains

  • A transmembrane domain (approximately 21 amino acids)

  • A cytoplasmic domain (approximately 345-346 amino acids) containing motifs implicated in endocytosis and signal transduction

Porcine ST7 shares 98% amino acid sequence homology with bovine and equine ST7 within the ECD, and 95% homology with human ST7, indicating high conservation across mammalian species .

How is porcine ST7 gene expression regulated in normal tissues?

Porcine ST7 is widely expressed in normal tissues, with particularly high expression in fibroblasts. The highest mRNA levels have been detected in heart and skeletal muscle tissues. The regulation pattern shows:

  • Tissue-specific expression patterns with varying intensities across different cell types

  • Potential alternative splicing, as genomic sequencing indicates the possibility of up to 18 splicing isoforms, though expression of these variants has not been well-studied

  • Conserved regulatory elements across species, suggesting similar transcriptional control mechanisms in pigs as observed in humans and other mammals

The expression regulation appears to be controlled by both tissue-specific transcription factors and epigenetic modifications, though the specific regulatory elements in the porcine ST7 promoter region require further characterization.

What techniques are recommended for expression and purification of recombinant pig ST7 protein?

For optimal expression and purification of recombinant pig ST7 protein, the following methodological approach is recommended:

Expression Systems:

  • E. coli expression system: Most commonly used for producing recombinant ST7 fragments, particularly for the extracellular domain

  • Mammalian expression systems: For full-length protein with proper post-translational modifications

Purification Protocol:

  • Add an affinity tag (His-tag is commonly used) to facilitate purification

  • Express in the selected system (bacterial or mammalian)

  • Lyse cells using appropriate buffer systems (Tris/PBS-based buffers at pH 8.0 work well)

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Further purify by size-exclusion chromatography if needed

  • Confirm purity (>90%) by SDS-PAGE analysis

Storage Recommendations:

  • Lyophilize in buffer containing 6% trehalose at pH 8.0

  • Store at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles

  • For working solutions, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

How can recombinant porcine ST7 be utilized in transgenic "oncopig" cancer models?

Recombinant porcine ST7 can be strategically incorporated into transgenic "oncopig" cancer models, serving as a crucial control or comparison element alongside known oncogenes and tumor suppressors:

Methodological Approach:

  • Generate transgenic pigs with inducible Cre recombinase systems similar to the established models for KRAS G12D and TP53 R167H

  • Include ST7 in the transgenic construct with tissue-specific promoters

  • Design the system to allow for temporal control of ST7 expression via Cre-loxP technology

  • Compare tumor development patterns with control oncopigs that lack ST7 modifications

Research Applications:

  • Investigate the tumor suppressor potential of ST7 by examining whether its overexpression decreases tumor incidence or progression in oncopig models

  • Study the interaction between ST7 and established oncogenic pathways (KRAS-driven pathways)

  • Evaluate tissue-specific effects by using different promoters to drive ST7 expression in various organs

  • Generate valuable preclinical data that bridges the gap between mouse models and human clinical trials due to the physiological similarities between pigs and humans

The large size and physiological similarity of pigs to humans make these oncopig models particularly valuable for studying the role of ST7 in cancer progression and treatment response.

What methodologies are most effective for studying interactions between porcine ST7 and extracellular matrix proteins?

To effectively study interactions between porcine ST7 and extracellular matrix (ECM) proteins, the following comprehensive methodological approaches are recommended:

In Vitro Binding Assays:

  • Surface Plasmon Resonance (SPR): Measure real-time binding kinetics between recombinant ST7 and purified ECM proteins (SPARC, IGFBP5)

  • Pull-down Assays: Use His-tagged recombinant ST7 as bait to identify binding partners from tissue extracts

  • Protein Microarrays: Screen for multiple ECM protein interactions simultaneously

Cell-based Assays:

  • Co-immunoprecipitation (Co-IP): Isolate ST7-ECM protein complexes from porcine cell lines

  • Proximity Ligation Assay (PLA): Visualize protein-protein interactions in situ

  • FRET/BRET Analysis: Measure protein interactions in live cells

Domain Mapping:

  • Generate truncated ST7 constructs containing specific domains (CUB domains or LDLR class A domains)

  • Compare binding affinities to identify critical interaction regions

  • Perform site-directed mutagenesis to pinpoint specific amino acids involved in interactions

Research indicates that ST7 expression is associated with downregulated expression of ECM molecules involved in remodeling, including SPARC, IGFBP5, and several matrix metalloproteinases. The interaction studies should focus on how ST7 modulates these ECM components through direct or indirect mechanisms .

What are the challenges and solutions for investigating ST7 phosphorylation patterns in porcine tissues?

Challenges in Studying ST7 Phosphorylation:

  • Multiple potential phosphorylation sites:

    • The cytoplasmic domain of ST7 contains numerous serine, threonine, and tyrosine residues

    • Different kinases may target different sites under varying conditions

  • Tissue-specific phosphorylation patterns:

    • Phosphorylation status may vary across different porcine tissues

    • Cell type-specific signaling networks influence phosphorylation

  • Low abundance and detection sensitivity:

    • Endogenous ST7 may be expressed at low levels

    • Phosphorylated forms represent a fraction of total protein

Methodological Solutions:

  • Enrichment Strategies:

    • Phosphopeptide enrichment using TiO₂ or IMAC (Immobilized Metal Affinity Chromatography)

    • Immunoprecipitation with phospho-specific antibodies prior to analysis

  • Mass Spectrometry Approaches:

    • Use parallel reaction monitoring (PRM) for targeted quantification

    • Apply label-free or isotopic labeling techniques (TMT, iTRAQ) for quantitative comparison

    • Implement SILAC in porcine cell culture systems for dynamic phosphoproteomics

  • Validation Methods:

    • Develop phospho-specific antibodies against predicted ST7 phosphosites

    • Use phosphatase treatments as negative controls

    • Compare wild-type ST7 with phospho-null mutants in functional assays

  • Computational Analysis:

    • Utilize phosphorylation prediction algorithms to identify high-probability sites

    • Perform conservation analysis across species to identify functionally important phosphosites

    • Model kinase-specific consensus sequences to predict responsible kinases

This multi-faceted approach allows researchers to comprehensively map ST7 phosphorylation patterns and understand their functional significance in porcine tissues.

How do porcine ST7 protein functions compare with human ST7 in terms of tumor suppression activity?

Comparative analysis of porcine and human ST7 proteins reveals both similarities and differences in tumor suppression activity:

Functional Similarities:

  • Both human and porcine ST7 share high sequence homology (95% in the ECD), suggesting conserved functions

  • The domain organization is identical, with CUB domains and LDLR class A domains in similar arrangements

  • Both proteins are widely expressed in normal tissues, with highest expression in heart and skeletal muscle

Notable Differences and Research Findings:

CharacteristicHuman ST7Porcine ST7Implications
Tumor suppression mechanismInconsistently downregulated in cancers; not clearly established as tumor suppressorLimited direct evidence in porcine modelsThe role as a tumor suppressor requires further validation in both species
Interaction with ECM proteinsAssociated with downregulation of SPARC, IGFBP5, MMPsSimilar interactions predicted but less studiedMay influence tissue remodeling in similar ways across species
Expression in cancer modelsVariable; sometimes upregulated in certain cancersLimited data from porcine cancer modelsDifferent contextual roles possible depending on cancer type and stage
Genetic alterationsLoss of heterozygosity reported in some human cancersLimited data on genetic alterations in porcine cancersGenetic mechanisms of inactivation may differ

The evidence suggests that while both human and porcine ST7 were originally proposed as tumor suppressors, neither consistently demonstrates this role across all cancers. In some contexts, ST7 expression may even be upregulated in certain cancers, suggesting a more complex role than simple tumor suppression .

What are the key differences in recombinant expression systems for porcine ST7 versus other species' ST7 proteins?

A comparative analysis of recombinant expression systems for porcine ST7 versus other species reveals important methodological considerations:

Expression System Comparisons:

Expression SystemPorcine ST7 CharacteristicsOther Species' ST7 (Human, Mouse, Sheep)Optimization Strategies
E. coliEfficient for ECD; potential for inclusion bodies due to multiple disulfide bondsSimilar challenges across species; human ST7 may show higher solubilityUse solubility tags (SUMO, MBP); express at lower temperatures (16-18°C); optimize codon usage for E. coli
Mammalian (HEK293, CHO)Best for full-length protein with proper folding and PTMsSimilar performance across species; slightly higher yields reported for human ST7Use strong promoters (CMV); optimize secretion signals; add protease inhibitors during purification
Insect Cell (Sf9, Hi5)Good compromise between bacterial and mammalian systemsWorks well for all species; differential glycosylation patternsOptimize MOI; harvest at optimal time points (typically 48-72h); add glycosylation inhibitors if needed
Cell-Free SystemsLimited success due to complex folding requirementsSimilar limitations across speciesSupplement with chaperones; add redox components for disulfide formation

Key Differential Considerations:

  • Codon Optimization:

    • Porcine ST7 expression benefits from specific codon optimization for the chosen expression system

    • Different optimization strategies may be needed compared to human or mouse ST7

  • Post-translational Modifications:

    • Slight differences in glycosylation sites between porcine and other species' ST7

    • Species-specific differences in disulfide bond formation efficiency

  • Solubility and Stability:

    • Porcine ST7 shows slightly different solubility profiles compared to human ST7

    • Species-specific buffer optimization may be required

These differences necessitate tailored expression and purification strategies when working with porcine ST7 compared to ST7 from other species .

What are the best approaches for developing specific antibodies against porcine ST7 for research applications?

Developing specific antibodies against porcine ST7 requires a strategic approach that considers the protein's characteristics and intended applications:

Antigen Design Strategies:

  • Full-length versus Fragment Approaches:

    • Recombinant full-length porcine ST7 (most comprehensive but challenging)

    • ECD fragments containing specific domains (CUB or LDLR domains)

    • Synthetic peptides from unique/antigenic regions (15-25 amino acids)

  • Epitope Selection Considerations:

    • Target regions with high antigenicity but low homology to other LDLR family members

    • Avoid highly conserved regions if species-specificity is required

    • Consider accessibility of epitopes in the native protein conformation

Antibody Development Methods:

  • Polyclonal Antibody Production:

    • Immunize rabbits or goats with recombinant porcine ST7 protein

    • Use adjuvant emulsification methods similar to those used for CD1d antibody preparation

    • Collect serum after multiple immunizations (typically 3-4 rounds)

    • Purify using Protein G affinity chromatography

  • Monoclonal Antibody Development:

    • Immunize mice with porcine ST7 antigen

    • Perform hybridoma fusion and screening

    • Select clones based on specificity, affinity, and application compatibility

    • Consider humanization if intended for therapeutic applications

Validation Methods:

  • Western blotting against recombinant protein and porcine tissue lysates

  • Immunoprecipitation to confirm native protein recognition

  • Immunofluorescence to verify cellular localization patterns

  • Cross-reactivity testing against human and rodent ST7 to determine specificity

The approach used for developing polyclonal antibodies against porcine CD1d protein provides a good methodological template that can be adapted for ST7 antibody development .

How can researchers effectively analyze ST7 function in porcine cell signaling pathways?

To effectively analyze ST7 function in porcine cell signaling pathways, researchers should implement a comprehensive strategy that integrates multiple methodological approaches:

Gene Modification Approaches:

  • CRISPR/Cas9-mediated Gene Editing:

    • Generate ST7 knockout porcine cell lines

    • Create point mutations in specific domains

    • Develop knock-in reporter systems (e.g., fluorescent tags)

  • Overexpression Systems:

    • Transiently transfect with wild-type or mutant ST7 constructs

    • Establish stable ST7-expressing cell lines

    • Use inducible expression systems for temporal control

Signaling Pathway Analysis:

  • Phosphorylation Cascade Mapping:

    • Immunoblotting with phospho-specific antibodies for key signaling molecules

    • Phosphoproteomics analysis before and after ST7 manipulation

    • Inhibitor studies to determine pathway dependencies

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation to identify binding partners

    • Proximity ligation assays to visualize interactions in situ

    • FRET/BRET approaches for real-time interaction analysis

Functional Readouts:

  • Transcriptional Effects:

    • RNA-seq to identify ST7-regulated genes

    • ChIP-seq to map transcription factor binding changes

    • Reporter assays for specific pathway activation

  • Cellular Phenotypes:

    • Proliferation, migration, and invasion assays

    • ECM remodeling assessment

    • Analysis of endocytosis and receptor trafficking

Porcine-Specific Considerations:

Researchers should establish porcine primary cell cultures (e.g., fibroblasts, myocytes) that naturally express ST7 at high levels. This provides a more physiologically relevant context than heterologous systems. The approach used for studying PEDV nsp7 interactions with interferon signaling components provides a valuable methodological framework that can be adapted for ST7 research .

What strategies are recommended for investigating ST7 interactions with other proteins in porcine disease models?

To comprehensively investigate ST7 interactions with other proteins in porcine disease models, researchers should implement a multi-faceted strategy:

In Vitro Interaction Mapping:

  • Yeast Two-Hybrid Screening:

    • Use ST7 domains as bait to screen porcine cDNA libraries

    • Validate interactions with targeted Y2H assays

    • Focus on tissue-specific libraries relevant to disease models

  • Protein Array Technologies:

    • Develop custom arrays with potential interacting partners

    • Use labeled recombinant ST7 as probe

    • Quantify binding affinities through fluorescence intensity

  • Pull-Down Assays and Mass Spectrometry:

    • Immobilize tagged ST7 protein as bait

    • Incubate with porcine tissue lysates from healthy and diseased samples

    • Identify bound proteins by LC-MS/MS

    • Perform comparative analysis between disease states

In Vivo Validation Approaches:

  • Proximity-Based Labeling:

    • Express ST7 fused to BioID or APEX2 in porcine cells

    • Identify proteins in close proximity through biotinylation

    • Compare interactome in normal versus disease states

  • Co-Immunoprecipitation from Tissues:

    • Extract protein complexes from relevant porcine tissues

    • Use anti-ST7 antibodies for immunoprecipitation

    • Analyze co-precipitated proteins

    • Compare disease models to healthy controls

Functional Validation:

  • Competitive Binding Assays:

    • Similar to how PEDV nsp7 competes with PP1 for binding to MDA5

    • Determine if ST7 competes with other proteins for binding partners

    • Quantify the impact on downstream signaling

  • Domain Mapping:

    • Generate truncated constructs to identify interaction domains

    • Create point mutations in key residues

    • Assess the impact on protein binding and function

  • Fluorescence-Based Interaction Assessment:

    • Implement FRET/BRET in porcine cell lines

    • Monitor real-time interactions under various conditions

    • Assess how disease-related stimuli affect interaction dynamics

The methodological approaches used to study PEDV nsp7 interactions provide an excellent template, particularly the competition assays and domain mapping strategies that revealed how viral proteins interfere with host signaling pathways .

How might porcine ST7 be involved in immune responses during viral infections such as PEDV or PRRSV?

The potential role of porcine ST7 in immune responses during viral infections represents an emerging research area with significant implications:

Theoretical Framework:

ST7 as a type I transmembrane protein with extensive extracellular domains may function as:

  • A pattern recognition co-receptor that modulates innate immune signaling

  • A regulator of cytokine receptor trafficking and turnover

  • A participant in virus entry or restriction mechanisms

Research Approach for Investigating ST7 in Viral Infections:

  • Expression Analysis During Infection:

    • Measure ST7 expression levels at different time points after PEDV or PRRSV infection

    • Analyze tissue-specific expression changes in infected pigs

    • Compare ST7 regulation across different viral strains (e.g., highly pathogenic vs. attenuated)

  • Functional Studies:

    • Generate ST7-overexpressing and ST7-knockout porcine cell lines

    • Challenge with viruses and measure:

      • Viral replication efficiency

      • Type I interferon production

      • NF-κB and IRF3 activation

      • Inflammatory cytokine profiles

  • Interaction Studies:

    • Investigate potential interactions between ST7 and viral proteins

    • Examine whether ST7 associates with immune signaling components like those targeted by PEDV nsp7

    • Assess if ST7 influences PP1-mediated dephosphorylation pathways similar to how PEDV nsp7 impacts MDA5

Current research on PEDV nsp7 shows it inhibits interferon production by targeting MDA5-mediated signaling. By comparison, ST7 might play a role in regulating similar immune pathways, potentially affecting viral replication and pathogenesis in porcine models .

What is the potential role of ST7 in oncopig models for translational cancer research?

The potential role of ST7 in oncopig models represents an exciting frontier in translational cancer research, bridging the gap between mouse models and human clinical applications:

Integration with Existing Oncopig Models:

The established oncopig model encoding inducible KRAS G12D and TP53 R167H mutations provides an excellent platform for studying ST7's role in cancer. This model could be expanded to include:

  • ST7 Modification Strategies:

    • CRISPR/Cas9-mediated knockout of endogenous ST7

    • Inducible expression of wild-type or mutant ST7

    • Tissue-specific ST7 modulation using appropriate promoters

  • Cancer Type Diversification:

    • Focus on cancer types where ST7 alterations have been reported in humans

    • Develop tissue-specific induction models using the Cre-loxP system similar to the PTF1A-iCre approach used for pancreatic cancer models

    • Create combination models examining ST7 in conjunction with other oncogenes/tumor suppressors

Translational Applications:

  • Therapeutic Testing Platform:

    • Evaluate ST7-targeted therapies in a physiologically relevant large animal model

    • Test combination approaches targeting ST7-related pathways

    • Provide better predictive value than mouse models due to similarities in physiology, metabolism, and genetics between pigs and humans

  • Biomarker Development:

    • Identify ST7-associated biomarkers in porcine models that translate to human patients

    • Validate diagnostic approaches in a model system more similar to humans

    • Establish prognostic indicators based on ST7 status

  • Tumor Microenvironment Studies:

    • Examine how ST7 influences the tumor microenvironment in a model with human-like tissue architecture

    • Study immune infiltration patterns in ST7-modified tumors

    • Assess ECM remodeling given ST7's known associations with ECM proteins

The oncopig model provides a unique opportunity to study ST7 in a genetically controlled system that more closely resembles human physiology than rodent models, potentially accelerating translational discoveries .

How can high-throughput methodologies advance our understanding of ST7 evolution and function across different pig breeds?

High-throughput methodologies offer powerful approaches to understand ST7 evolution and function across pig breeds:

Comparative Genomics Approaches:

  • Whole Genome Sequencing Analysis:

    • Compare ST7 gene sequences across traditional pig breeds and wild boar populations

    • Identify breed-specific polymorphisms and structural variations

    • Map selective pressure on ST7 through evolutionary analysis

    • Calculate Ka/Ks ratios to determine evolutionary constraints on different domains

  • Transcriptomic Profiling:

    • Implement RNA-seq across multiple tissues from diverse pig breeds

    • Identify breed-specific expression patterns of ST7 and its isoforms

    • Correlate expression patterns with phenotypic characteristics

    • Analyze co-expression networks to identify functional associations

Functional Genomics Methods:

  • CRISPR/Cas9 Screens:

    • Perform genome-wide CRISPR screens in cells derived from different pig breeds

    • Identify genetic interactions with ST7

    • Compare genetic dependencies across breed-specific cellular backgrounds

  • Proteomics Analysis:

    • Apply quantitative proteomics to compare ST7 protein levels across breeds

    • Identify breed-specific post-translational modifications

    • Analyze protein-protein interaction networks in different genetic backgrounds

Breed-Specific Considerations:

Researchers should consider including:

  • Commercial breeds with different production traits (Yorkshire, Duroc, Landrace)

  • Traditional local breeds with unique genetic characteristics

  • Wild boar populations as evolutionary reference points

  • Specialized breeds with disease resistance traits

The methodological approaches used in tracking the evolution of viruses like Streptococcus suis provide useful templates for analyzing genetic diversity and evolution of host genes like ST7 across pig populations .

How can CRISPR/Cas9 gene editing be optimized for studying ST7 function in porcine models?

Optimizing CRISPR/Cas9 gene editing for studying ST7 function in porcine models requires careful consideration of several technical aspects:

gRNA Design and Validation:

  • Target Site Selection:

    • Design gRNAs targeting functional domains (CUB domains, LDLR class A domains)

    • Create knockout strategies targeting early exons to ensure complete loss of function

    • Implement knock-in approaches for adding reporters or introducing specific mutations

  • Porcine-Specific Optimization:

    • Use porcine genome databases to ensure target specificity

    • Check for breed-specific polymorphisms that might affect gRNA binding

    • Validate gRNAs in porcine cell lines before in vivo application

Delivery Methods for Porcine Systems:

  • In vitro Applications:

    • Nucleofection for primary porcine cells (fibroblasts, kidney cells)

    • Lentiviral delivery for stable Cas9 and gRNA expression

    • Ribonucleoprotein (RNP) complex delivery for reduced off-target effects

  • In vivo Applications:

    • Somatic cell nuclear transfer (SCNT) after editing fibroblasts

    • Direct injection of CRISPR components into zygotes

    • Adeno-associated virus (AAV) delivery for tissue-specific editing

Advanced Editing Strategies:

  • Precise Modifications:

    • Base editing for introducing point mutations without double-strand breaks

    • Prime editing for more complex sequence changes

    • Homology-directed repair (HDR) templates optimized for porcine cells

  • Conditional Systems:

    • Integration with Cre-loxP technology as demonstrated in PTF1A-iCre pigs

    • Inducible CRISPR systems using doxycycline-responsive promoters

    • Tissue-specific Cas9 expression using appropriate promoters

The successful CRISPR/Cas9-mediated insertion of iCre into the porcine PTF1A gene provides an excellent methodological template that can be adapted for ST7 modification. This approach ensures tissue and cell type-specific function while minimizing off-target effects .

What novel imaging techniques can be applied to track ST7 protein dynamics in porcine tissues?

Advanced imaging techniques offer powerful tools for tracking ST7 protein dynamics in porcine tissues with unprecedented spatial and temporal resolution:

Fluorescent Protein Tagging Approaches:

  • CRISPR Knock-in Strategies:

    • Generate pigs with endogenous ST7 tagged with fluorescent proteins (mNeonGreen, mScarlet)

    • Create dual fluorescent reporter systems similar to those used in PTF1A-iCre pigs

    • Implement split-fluorescent protein systems to monitor protein-protein interactions

  • Photoconvertible and Photoswitchable Proteins:

    • Tag ST7 with proteins like Dendra2 or mEos to track protein movement over time

    • Use regional photoconversion to monitor protein trafficking between cellular compartments

    • Implement pulse-chase imaging to determine protein turnover rates

Advanced Microscopy Techniques:

  • Super-Resolution Microscopy:

    • Apply STED, PALM, or STORM microscopy to visualize ST7 distribution at nanoscale resolution

    • Track ST7 clustering at the membrane and association with lipid rafts

    • Monitor interactions with other membrane proteins beyond the diffraction limit

  • Live Tissue Imaging:

    • Implement multi-photon microscopy for deep tissue imaging in ex vivo porcine samples

    • Use light-sheet microscopy for rapid 3D visualization of tissue sections

    • Apply fluorescence lifetime imaging (FLIM) to detect protein-protein interactions via FRET

  • Intravital Microscopy Adaptations:

    • Develop minimally invasive approaches for imaging ST7 in living porcine tissues

    • Use implantable gradient index (GRIN) lenses for deep tissue access

    • Implement miniaturized microscopes for longitudinal studies

Molecular Probes and Biosensors:

  • Antibody-Based Detection:

    • Develop high-affinity nanobodies against porcine ST7 for live-cell imaging

    • Implement click chemistry approaches for specific labeling

    • Use antibody fragments conjugated to bright, photostable fluorophores

  • Functional Biosensors:

    • Create conformational biosensors to detect ST7 activation states

    • Develop FRET-based activity reporters for ST7-associated signaling

    • Implement proximity sensors to detect interactions with binding partners

These advanced imaging approaches can reveal ST7 dynamics in physiologically relevant contexts that are difficult to study with traditional biochemical methods .

What are the most promising directions for studying the role of porcine ST7 in modulating host-pathogen interactions?

Several promising research directions emerge for understanding porcine ST7's role in host-pathogen interactions:

Intersection with Viral Pathogenesis:

  • ST7 as a Potential Viral Receptor or Co-receptor:

    • Investigate whether ST7's extracellular domain interacts with viral envelope proteins

    • Determine if ST7 expression levels correlate with susceptibility to specific viruses

    • Examine ST7 involvement in viral entry pathways using CRISPR knockout and overexpression models

  • Intersection with Innate Immune Signaling:

    • Explore whether ST7 modulates signaling pathways targeted by viral proteins like PEDV nsp7

    • Investigate potential interactions with pattern recognition receptors (PRRs)

    • Determine if ST7 influences interferon responses during viral infection

Bacterial Pathogen Interactions:

  • ST7 Role in Streptococcus suis Infections:

    • Examine ST7 expression changes during S. suis infection

    • Investigate potential direct interactions between ST7 and bacterial virulence factors

    • Compare responses across S. suis strains with different virulence profiles (ST1, ST7, ST25)

  • Modulation of Inflammatory Responses:

    • Assess how ST7 influences cytokine production during bacterial infections

    • Determine if ST7 affects neutrophil recruitment or macrophage polarization

    • Investigate ST7's impact on bacterial clearance mechanisms

Methodological Approaches:

  • Ex Vivo Infection Models:

    • Develop precision-cut lung slices from pigs with modified ST7 expression

    • Establish organoid models from various porcine tissues to study infection in 3D context

    • Implement air-liquid interface cultures for respiratory pathogen studies

  • In Vivo Challenge Studies:

    • Generate ST7-modified pigs using CRISPR/Cas9 technology

    • Challenge with key porcine pathogens (PRRSV, PEDV, S. suis)

    • Monitor disease progression, viral/bacterial loads, and immune responses

The established methodologies used to study host interactions with porcine pathogens like PEDV, PRRSV, and S. suis provide excellent templates for investigating ST7's role in these processes .

How might comparative studies between human and porcine ST7 inform translational research and therapeutic development?

Comparative studies between human and porcine ST7 offer significant opportunities for translational research and therapeutic development:

Structural and Functional Homology Analysis:

  • Domain-Specific Conservation:

    • Identify highly conserved domains as potential therapeutic targets

    • Map species-specific differences that might affect drug binding

    • Determine if functional differences exist despite high sequence homology (95-98%)

  • Regulatory Mechanism Comparison:

    • Compare transcriptional regulation between species

    • Identify conserved post-translational modifications

    • Determine if protein-protein interaction networks are preserved

Translational Applications:

  • Porcine Models as Preclinical Platforms:

    • Develop humanized ST7 pigs to better model human disease

    • Test ST7-targeted therapies in physiologically relevant systems

    • Validate biomarkers identified in porcine models for human applications

  • Therapeutic Development Strategy:

    • Target highly conserved domains for broader applicability

    • Develop monoclonal antibodies that recognize both human and porcine ST7

    • Use porcine systems to optimize dosing and delivery methods

Methodological Framework:

Research AspectComparative ApproachExpected Outcome
Genetic ModificationGenerate equivalent mutations in both species' cell linesIdentify conserved phenotypes and species-specific differences
Drug ResponseTest candidate compounds against both human and porcine ST7Determine predictive value of porcine models for human applications
Disease ModelingCreate parallel disease models in porcine systems and human cell linesEstablish translation validity of pig models
Pathway AnalysisCompare signaling networks involving ST7 in both speciesIdentify shared nodes for therapeutic targeting

The high degree of homology between human and porcine ST7 (98% in the extracellular domain) suggests that therapeutic approaches developed in porcine models have high potential for translation to human applications. This is particularly valuable given the physiological similarities between pigs and humans that are lacking in rodent models .

How can researchers optimize cross-disciplinary approaches to study porcine ST7 in both veterinary medicine and human disease contexts?

Optimizing cross-disciplinary approaches for porcine ST7 research requires strategic collaboration between veterinary medicine and human disease research:

Collaborative Framework Design:

  • Integrated Research Teams:

    • Pair veterinary researchers with human disease specialists

    • Include molecular biologists, pathologists, and clinicians from both fields

    • Incorporate bioengineers for developing shared technological platforms

  • Shared Resource Development:

    • Establish biobanks with matched porcine and human samples

    • Develop antibody panels that recognize both species' ST7 proteins

    • Create computational platforms for cross-species data integration

Methodological Standardization:

  • Harmonized Protocols:

    • Develop consistent tissue collection and processing methods

    • Standardize assay conditions for comparative studies

    • Implement shared bioinformatics pipelines for data analysis

  • Parallel Model Systems:

    • Design experiments with matched porcine and human cell systems

    • Develop organoid models from both species using identical protocols

    • Create equivalent genetic modifications in porcine and human cells

Translational Research Pipeline:

  • Bidirectional Knowledge Transfer:

    • Apply findings from spontaneous porcine diseases to human medicine

    • Translate human disease insights to improve veterinary treatments

    • Develop shared biomarkers relevant to both species

  • Collaborative Funding Approaches:

    • Target funding mechanisms that support One Health initiatives

    • Develop proposals highlighting both veterinary and human health impacts

    • Create industry partnerships spanning both sectors

The development of porcine cancer models like the "oncopig" provides an example of successful cross-disciplinary collaboration, where veterinary expertise in pig genetics and physiology combined with human cancer research approaches to create valuable translational models .

What standardized research protocols would facilitate multi-institutional studies of porcine ST7 protein?

Standardized research protocols are essential for ensuring reproducibility and data compatibility in multi-institutional studies of porcine ST7 protein:

Sample Collection and Processing:

  • Tissue Acquisition Protocol:

    • Standardized collection timepoints (relative to age, disease stage)

    • Consistent anatomical sampling locations

    • Uniform preservation methods (flash freezing, RNAlater, formalin fixation)

  • Primary Cell Isolation:

    • Harmonized enzymatic digestion protocols

    • Standardized cell purification methods

    • Consistent culture conditions and media formulations

Molecular Analysis Methods:

  • Gene Expression Analysis:

    • Common reference genes for qPCR normalization in porcine tissues

    • Standardized RNA extraction and quality control metrics

    • Shared bioinformatics pipelines for RNA-seq analysis

  • Protein Analysis:

    • Validated antibody panels with confirmed specificity for porcine ST7

    • Standardized Western blot conditions

    • Unified protocols for immunohistochemistry and scoring systems

Functional Assays:

  • Cell-Based Assays:

    • Consensus cell lines and passage numbers

    • Standardized transfection/transduction protocols

    • Unified readout parameters and analytical methods

  • Animal Model Standards:

    • Consistent genetic backgrounds for pig models

    • Standardized husbandry conditions

    • Uniform disease induction and monitoring protocols

Data Sharing Framework:

  • Centralized Data Repository:

    • Common data structure and format requirements

    • Standardized metadata collection

    • Integration with existing animal and human databases

  • Quality Control Measures:

    • Regular proficiency testing between participating laboratories

    • Reference sample distribution for methodological calibration

    • Standard operating procedures for all key techniques

The collaborative approaches used in tracking emerging strains of porcine pathogens across multiple institutions provide excellent templates for establishing multi-institutional research networks focused on porcine ST7 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.