Recombinant Pig Tetraspanin-31 (TSPAN31)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Pig Tetraspanin-31 (TSPAN31) is a laboratory-produced version of the porcine tetraspanin-31 protein, a member of the transmembrane 4 superfamily (tetraspanins). Tetraspanins are evolutionarily conserved four-transmembrane proteins involved in cell adhesion, proliferation, motility, and signal transduction by forming dynamic membrane microdomains called tetraspanin-enriched microdomains (TEMs) . TSPAN31, specifically, is linked to growth-related cellular processes and has been implicated in tumorigenesis in humans .

Research Challenges and Opportunities

  • Functional Studies: No direct data on pig TSPAN31’s role in disease exist. Comparative studies with human TSPAN31 (linked to gastric cancer progression ) could illuminate conserved pathways.

  • Structural Analysis: The recombinant protein’s LEL domain (critical for interactions) remains uncharacterized in pigs but shares >74% sequence identity with rodents .

Key Data from Homologous Proteins

Human and mouse TSPAN31 studies highlight its oncogenic role:

FindingModel SystemMechanismReference
Overexpression in GCHuman gastric cancerActivates PI3K-Akt pathway; induces EMT
ChemoresistanceHuman GC cellsSuppresses ABCC2 transporter upon knockdown
Tumor growth inhibitionMouse xenograftsTSPAN31 knockdown reduces proliferation

Future Directions

  • Mechanistic Studies: Investigate pig TSPAN31’s role in porcine disease models.

  • Therapeutic Targeting: Explore antibody or small-molecule inhibitors, akin to human CD151-targeting strategies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will then prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN31; SAS; Tetraspanin-31; Tspan-31; Sarcoma-amplified sequence homolog; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
TSPAN31
Target Protein Sequence
MVCGGFACSKNALCALNVVYMLVGLLLIGVAAWAKGLGLVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFGISCSCLAINLSKQAGIIN
Uniprot No.

Target Background

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TSPAN31 and how does the porcine variant compare to human TSPAN31?

TSPAN31 belongs to the tetraspanin family of transmembrane proteins characterized by four highly hydrophobic transmembrane domains (TM1-TM4), which delineate two extracellular loops (SEL and LEL), one intracellular loop (IL), and short cytoplasmic N- and C-terminal tails. Like other tetraspanins, TSPAN31 likely contains conserved cysteine residues in its large extracellular loop (LEL) that form disulfide bonds critical for proper protein folding and stability .

Porcine TSPAN31 shares significant homology with human TSPAN31, though specific differences in the variable regions of the LEL may affect interaction partners. Human TSPAN31 is encoded by a gene located on chromosome 12q13-q14 and has several synonyms including SAS (sarcoma amplified sequence) . Researchers should note that while the core structural features are conserved across species, functional equivalence cannot be assumed without experimental validation.

What are the recommended expression systems for recombinant pig TSPAN31?

When expressing recombinant pig TSPAN31, researchers should consider:

  • Bacterial systems (E. coli): Suitable for producing partial domains (especially the LEL) for structural studies and antibody generation, though often lacking post-translational modifications present in native protein . E. coli-expressed TSPAN31 typically requires refolding protocols to establish proper disulfide bonds.

  • Mammalian expression systems: HEK293 or CHO cells provide superior post-translational modifications and membrane insertion for full-length TSPAN31. These systems are recommended when functional studies are planned.

  • Insect cell systems: Baculovirus-infected insect cells offer a middle ground between bacterial and mammalian systems, with moderate post-translational modification capability and higher yield than mammalian cells.

The choice depends on research objectives - structural studies may tolerate E. coli expression, while interaction studies with other membrane proteins generally require mammalian expression systems.

What purification strategies are most effective for recombinant pig TSPAN31?

Purification of recombinant TSPAN31 typically follows this methodological approach:

  • Affinity chromatography: His-tagging at either terminus allows for Ni-sepharose purification, as demonstrated with human TSPAN31 . For pig TSPAN31, careful tag placement is crucial to avoid interfering with functional domains.

  • Detergent selection: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin better preserve tetraspanin structure compared to more harsh detergents like SDS or Triton X-100, which may disrupt tetraspanin-enriched microdomains (TEMs) .

  • Size exclusion chromatography: This secondary purification step helps separate monomeric TSPAN31 from aggregates and other contaminating proteins.

  • Buffer optimization: Purified tetraspanins often benefit from the presence of stabilizing agents such as glycerol (typically 15%) to prevent aggregation during storage .

The table below summarizes recommended purification conditions:

Purification StepRecommended ConditionsCritical Considerations
LysisPBS with 1% DDM or 0.7% SarcosylTemperature control (4°C)
Affinity ChromatographyNi-sepharose with imidazole gradientImidazole concentration (50-300mM)
Size ExclusionPBS with 0.05% DDMFlow rate affects resolution
StoragePBS with 15% glycerol at -20°CAvoid repeated freeze-thaw cycles

How can researchers effectively study pig TSPAN31's role in tetraspanin-enriched microdomains (TEMs)?

Investigating TSPAN31's role in TEMs requires specialized approaches:

  • Co-immunoprecipitation assays: Using anti-TSPAN31 antibodies to pull down associated proteins from porcine cell membranes after mild detergent solubilization (1% Brij-97 preserves many tetraspanin-tetraspanin interactions).

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify proteins in close proximity to TSPAN31 in living cells, providing insights into the composition of TEMs containing TSPAN31.

  • Super-resolution microscopy: Techniques like STORM or PALM can visualize the nanoscale organization of TSPAN31 in TEMs with other membrane proteins.

  • Blue native PAGE: This technique preserves protein-protein interactions and can separate intact TEMs for downstream analysis of composition.

When interpreting results, researchers should consider that TEMs are dynamic structures, and their composition may change depending on cellular context and experimental conditions. Comparison between results obtained with recombinant versus native TSPAN31 is essential to validate findings .

What methods are most appropriate for investigating potential viral interactions with pig TSPAN31?

While specific interactions between pig TSPAN31 and viruses have not been extensively characterized, methodological approaches can be adapted from studies of other tetraspanins:

  • Viral overlay assays: Purified recombinant pig TSPAN31 (particularly the LEL domain) can be immobilized and probed with labeled viral particles or viral envelope proteins to detect direct interactions.

  • Surface plasmon resonance (SPR): This technique provides quantitative binding kinetics between immobilized TSPAN31 and viral proteins in real-time.

  • Competitive inhibition studies: Recombinant soluble LEL domains can be tested for their ability to interfere with viral infection in porcine cell cultures, as demonstrated with CD81 for HCV infection .

  • CRISPR/Cas9 knockout/knockin studies: Generate TSPAN31-deficient porcine cell lines to assess changes in susceptibility to viral infection.

  • Co-localization studies: Immunofluorescence microscopy to track viral particles relative to TSPAN31 during different stages of viral entry and replication.

Research should focus on porcine viruses with entry mechanisms similar to those known to interact with other tetraspanins, such as porcine reproductive and respiratory syndrome virus (PRRSV), which has been shown to interact with CD151 in viral entry .

How can researchers validate the correct folding and functionality of recombinant pig TSPAN31?

Validation of recombinant pig TSPAN31 should include multiple complementary approaches:

  • Circular dichroism spectroscopy: Confirms secondary structure elements expected for tetraspanins.

  • Disulfide bond verification: Mass spectrometry analysis can confirm the formation of expected disulfide bonds in the LEL, critical for proper folding.

  • Thermal shift assays: Properly folded proteins typically exhibit cooperative unfolding transitions.

  • Functional binding assays: Testing interaction with known tetraspanin partners (if identified for pig TSPAN31).

  • Conformational antibodies: Development of antibodies that recognize conformational epitopes rather than linear sequences can help distinguish properly folded protein.

A properly folded recombinant TSPAN31 should demonstrate stability in solution and the ability to interact with known binding partners in a manner comparable to native protein extracted from porcine tissues .

What are the critical considerations when designing experiments to study TSPAN31 interactions with other membrane proteins?

Successful investigation of TSPAN31 interactions requires careful experimental design:

  • Detergent selection: Different detergents preserve different interaction types. For example:

    • Stringent detergents (Triton X-100): Preserve primary (direct) interactions

    • Mild detergents (Brij97, CHAPS): Preserve secondary (indirect) interactions within TEMs

  • Control experiments: Include:

    • Negative controls (other tetraspanins known not to interact with target protein)

    • Positive controls (well-characterized tetraspanin interactions)

    • Validation in multiple cell types (e.g., primary porcine cells vs. cell lines)

  • Tag interference assessment: Compare results with N-terminal vs. C-terminal tagged constructs to identify potential tag interference with interactions.

  • Reciprocal co-immunoprecipitation: Confirm interactions by pulling down from both directions (anti-TSPAN31 and anti-partner protein).

The table below outlines recommended approaches based on interaction type:

Interaction TypeRecommended MethodRequired Controls
Direct protein bindingCo-IP with stringent detergentsTag-only control
TEM associationCo-IP with mild detergentsOther tetraspanin controls
Transient interactionsCrosslinking before lysisNon-crosslinked control
Functional associationFRET/BRET assaysDonor/acceptor-only controls

What approaches should be used to study the role of recombinant pig TSPAN31 in viral infections?

Investigating TSPAN31's role in viral infections requires multilevel experimental approaches:

  • Loss-of-function studies:

    • siRNA knockdown in porcine cell lines

    • CRISPR/Cas9 gene editing to create TSPAN31-deficient cells

    • Dominant-negative TSPAN31 constructs (particularly LEL domain overexpression)

  • Gain-of-function studies:

    • Overexpression of wildtype and mutant TSPAN31 in porcine cells

    • Complementation of TSPAN31-knockout cells with modified TSPAN31 variants

  • Temporal analysis:

    • Time-course experiments to determine at which stage of viral infection TSPAN31 functions

    • Synchronized infection protocols with specific inhibitors at different stages

  • Viral binding assays:

    • Recombinant soluble LEL competition assays

    • TSPAN31-expressing cells vs. control cells viral attachment comparison

While specific data for pig TSPAN31 and viral interactions is limited, researchers can adapt methodologies from studies of other tetraspanins like CD81 (HCV), CD9 (CoV), and CD151 (IAV) which demonstrate roles in various stages of viral infection including entry, replication, assembly, and release .

How can researchers differentiate between direct and indirect effects of TSPAN31 in experimental systems?

Distinguishing direct from indirect effects requires careful experimental design:

  • Domain-specific mutations: Introducing point mutations in specific TSPAN31 domains can identify regions directly involved in interactions versus those required for proper membrane localization.

  • Chimeric tetraspanin constructs: Creating chimeras between TSPAN31 and other tetraspanins can help map functional domains.

  • Proximity labeling approaches: BioID or APEX2 fusions can identify proteins in close proximity to TSPAN31 in intact cells.

  • In vitro reconstitution: Purified components in liposomes or nanodiscs can test direct interactions in minimal systems.

  • Real-time imaging: Single-molecule tracking can reveal direct binding events versus co-localization due to membrane compartmentalization.

Researchers should be aware that tetraspanins often function through both direct molecular interactions and indirect effects via their organization of TEMs, making this distinction particularly challenging for this protein family .

What are the most common pitfalls when working with recombinant pig TSPAN31 and how can they be addressed?

Researchers commonly encounter several challenges when working with tetraspanins including TSPAN31:

  • Protein aggregation: Tetraspanins contain hydrophobic transmembrane domains prone to aggregation.

    • Solution: Optimize detergent type and concentration; add stabilizers like glycerol (15%) or specific lipids; avoid repeated freeze-thaw cycles .

  • Low expression yields: Membrane proteins often express poorly.

    • Solution: Test multiple expression systems; optimize codon usage for target expression system; reduce expression temperature; use fusion partners known to enhance expression.

  • Improper folding: Particularly problematic for the LEL domain with its critical disulfide bonds.

    • Solution: Include oxidizing agents during refolding; express in eukaryotic systems with proper disulfide bond formation machinery; validate folding by functional assays.

  • Interference from affinity tags: Tags may affect protein function or interaction.

    • Solution: Test multiple tag positions; include tag-removal options (TEV protease sites); compare results with differently tagged versions.

  • Non-specific binding in interaction studies: Hydrophobic nature of tetraspanins can lead to false positives.

    • Solution: Include appropriate detergent controls; use stringent washing conditions; validate interactions with multiple methods.

How should researchers interpret contradictory results when studying pig TSPAN31 function?

When facing contradictory results:

  • Consider context-dependency: Tetraspanin function often depends on:

    • Cell type and tissue of origin

    • Expression level (overexpression vs. physiological levels)

    • Presence of binding partners that may differ between systems

    • Membrane composition affecting TEM formation

  • Evaluate methodology differences:

    • Detergent conditions significantly affect tetraspanin interactions

    • Tag position and type may interfere differently with function

    • In vitro vs. cellular assays may yield different results due to missing cofactors

  • Validate with complementary approaches:

    • Combine genetic (knockdown/knockout) with biochemical methods

    • Use both gain-of-function and loss-of-function studies

    • Apply both in vitro and cellular systems

  • Consider redundancy among tetraspanins:

    • Other tetraspanins may compensate for TSPAN31 in knockout models

    • Double or triple knockdowns may be necessary to observe phenotypes

When publishing, researchers should transparently report contradictory results and discuss potential explanations for discrepancies.

What are promising new methodologies for studying pig TSPAN31 interactions in membrane microdomains?

Several cutting-edge approaches show promise for tetraspanin research:

  • Cryo-electron microscopy: Recent advances allow visualization of membrane protein complexes in near-native environments. This could reveal how TSPAN31 organizes within TEMs at molecular resolution.

  • Mass spectrometry of intact membrane complexes: Native mass spectrometry can now analyze intact membrane protein complexes with associated lipids, offering insights into TEM composition.

  • Genome-wide CRISPR screens: These can identify genes that modify TSPAN31 function in specific biological processes, revealing unexpected pathways.

  • Nanobodies and single-domain antibodies: These smaller antibody fragments offer improved access to cryptic epitopes in membrane proteins and reduced interference with function.

  • Organoid models: Porcine intestinal or respiratory organoids provide more physiologically relevant systems for studying TSPAN31 function compared to standard cell lines.

  • Artificial intelligence for structure prediction: Tools like AlphaFold2 can predict tetraspanin structures and interaction interfaces when experimental structures are unavailable.

These approaches can help overcome traditional limitations in studying tetraspanin biology, particularly for less-characterized members like TSPAN31 .

How might recombinant pig TSPAN31 contribute to understanding cross-species viral transmission?

Recombinant pig TSPAN31 may offer insights into zoonotic transmission mechanisms:

  • Comparative binding studies: Directly compare binding of viral proteins to pig versus human TSPAN31 to identify species barriers or transmission facilitators.

  • Chimeric TSPAN31 constructs: Creating pig/human chimeric proteins can map domains responsible for species-specific interactions.

  • Adaptation studies: In vitro evolution experiments can reveal how viruses adapt to utilize TSPAN31 from different species.

  • TEMs comparative analysis: Characterizing differences in TEM composition between porcine and human cells may reveal co-factors that influence species specificity.

  • Structural biology approaches: Solving structures of viral proteins bound to pig versus human TSPAN31 can identify molecular determinants of species specificity.

Understanding these interactions could help predict and prevent zoonotic transmission events of porcine viruses to humans, particularly for viruses known to utilize tetraspanins in their life cycles .

Citations Distinctive function of Tetraspanins: Implication in viral infections. (2025). Recombinant Human TSPAN31, His-tagged - Creative BioMart. (2025).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.