Recombinant Pig TGF-beta receptor type-2 (TGFBR2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Pig TGFBR2 is a synthetically produced transmembrane receptor protein belonging to the serine/threonine kinase family. It binds TGF-β ligands and initiates intracellular signaling through phosphorylation of SMAD proteins, regulating cell proliferation, differentiation, and extracellular matrix remodeling .

Production and Purification

Recombinant Pig TGFBR2 is typically expressed in mammalian or insect cell systems to ensure proper post-translational modifications.

Production Systems:

Host SystemPurityTagApplications
Human Cells>95%His, FcELISA, Western Blot
Insect Cells (Sf9)≥85%Non-taggedDrug screening
E. coli≥80%GST, T7Structural studies

Key Notes:

  • Mammalian systems (e.g., HEK293) preserve native glycosylation patterns critical for ligand binding .

  • Purity is validated via SDS-PAGE and reducing conditions .

Signaling Pathway Activation

Recombinant TGFBR2 enables study of TGF-β’s dual role in tumor suppression and fibrosis promotion. Key findings include:

Assay TypeResultSource
SMAD PhosphorylationMutant TGFBR2 (R460C/R460H) reduces SMAD2/3 activation by 60–70% PMC2972687
Gene ExpressionTGFBR2 mutants fail to upregulate α-actin/calponin in SMCs PMC2972687
Reporter Genep3TP-Lux assays show 80% reduced activity in kinase-domain mutants PMC2972687

Disease Associations

  • Aortic Aneurysms: TGFBR2 mutations (e.g., R528H) impair smooth muscle cell contractility, leading to aortic wall degradation .

  • Cancer: Reduced TGFBR2 expression correlates with prostate cancer progression, while hyperactivation links to lung cancer metastasis .

Therapeutic Development

  • Drug Screening: Used to evaluate kinase inhibitors targeting TGF-β pathways in fibrosis and Marfan syndrome .

  • Gene Therapy: Restoring TGFBR2 function in mutant SMCs reverses contractile protein deficits in vitro .

Diagnostic Biomarkers

  • Serum TGFBR2 levels are being explored as prognostic markers for thoracic aortic dissection .

Case Study: TGFBR2 in Smooth Muscle Cell Dysfunction

A 2018 study demonstrated that TGFBR2 mutations (R460C/R460H) disrupt actin cytoskeleton organization in vascular SMCs, leading to:

  • 50% reduction in calponin expression.

  • 70% decrease in collagen synthesis.

  • Impaired TGF-β-mediated upregulation of contractile genes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
TGFBR2; TGF-beta receptor type-2; TGFR-2; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; TGF-beta receptor type II; TbetaR-II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-297
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
IPPHVPKSVNSDMMVTDSNGAVKLPQLCKFCDVRSSTCDNQKSCLSNCSITAICEKPQEV CVAVWRKNDENITIETVCDDPKIAYHGFVLDDAASSKCIMKERKGSGETFFMCSCSSDEC NDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIITFYCYRVHRQQKLSPSWDS GKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKL RQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDL
Uniprot No.

Target Background

Function
TGF-beta receptor type-2 (TGFBR2) is a transmembrane serine/threonine kinase that forms a complex with the TGF-beta type I serine/threonine kinase receptor (TGFBR1), serving as the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2, and TGFB3. It transduces the TGFB1, TGFB2, and TGFB3 signal from the cell surface to the cytoplasm, regulating a wide range of physiological and pathological processes, including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. The receptor complex comprises two TGFBR1 and two TGFBR2 molecules symmetrically bound to the cytokine dimer, leading to the phosphorylation and activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 then phosphorylates SMAD2, which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex translocates to the nucleus, modulating the transcription of TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. TGFBR2 is also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
Database Links
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.

Q&A

What is TGFBR2 and how does it function in TGF-beta signaling pathways?

TGFBR2 is a transmembrane protein with a serine/threonine protein kinase domain that forms a heterodimeric complex with TGF-beta receptor type-1 (TGFBR1) and binds TGF-beta ligands. When TGF-beta ligands bind to TGFBR2, it activates its intrinsic tyrosine kinase activity, which then phosphorylates and activates TGFBR1. This receptor/ligand complex triggers intracellular signaling pathways that regulate transcription of genes related to cell proliferation, differentiation, migration, apoptosis, and extracellular matrix production .

The signaling cascade proceeds through both classical Smad-dependent pathways and non-classical Smad-independent pathways:

  • Smad-dependent pathway: TGFBR2 activation leads to phosphorylation of Smad2 and Smad3, which then bind to Smad4 to form complexes that migrate to the nucleus and regulate gene expression .

  • Smad-independent pathway: Involves MAPK, PI3K/Akt, and Rho GTPase signaling pathways that affect various cellular functions .

This dual pathway activation allows for the diverse and context-dependent cellular responses observed with TGF-beta signaling.

What expression systems are effective for recombinant pig TGFBR2 production?

Several expression systems have been utilized for recombinant TGFBR2 production, each with distinct advantages. For pig TGFBR2 specifically, the following approaches have shown effectiveness:

  • Mammalian cell expression systems: Human cell lines such as Expi293F cells (HEK293 derivatives) have demonstrated high efficiency for recombinant TGF-beta receptor production. These systems provide proper post-translational modifications, particularly glycosylation, which is often crucial for receptor functionality .

  • Insect cell expression systems: Sf9 cells have been used for TGF-beta receptor family proteins, offering a balance between proper protein folding and production yield .

  • E. coli expression systems: While bacterial systems typically lack glycosylation capacity, they can be useful for producing specific domains of TGFBR2 for structural studies .

Transient transfection systems using human Expi293F cells have shown particular promise, yielding >2 mg of pure histidine- or Strep-tagged protein per liter of cell culture. These systems offer flexibility, allowing constructs to be changed and retested rapidly with comparable yields to stable systems .

How should recombinant TGFBR2 be stored and handled to maintain stability?

Optimal storage and handling of recombinant TGFBR2 requires careful attention to several parameters:

  • Lyophilization: Recombinant proteins are often lyophilized from filtered solutions (typically 0.2 μm filtered) containing appropriate buffer components .

  • Reconstitution: For optimal stability, reconstitute lyophilized TGFBR2 in acidic conditions (e.g., 4 mM HCl) containing protein stabilizers such as human or bovine serum albumin (0.1% or higher) .

  • Storage temperature: Use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity. Long-term storage should be at -20°C to -80°C .

  • Shipping conditions: While shipping may occur at ambient temperature, immediate transfer to recommended storage conditions upon receipt is critical .

This methodological approach to handling ensures that the recombinant protein maintains its structural integrity and functional properties for experimental applications.

What crystallization techniques are effective for structural studies of recombinant TGFBR2?

Structural studies of recombinant TGFBR2 require sophisticated crystallization approaches:

  • Protein preparation: High-purity protein (>95% homogeneity) is essential, typically achieved through multi-step purification including affinity chromatography (using histidine or Strep tags), followed by size exclusion chromatography .

  • Crystallization screening: Systematic screening of crystallization conditions varying precipitant type/concentration, pH, temperature, and additives is necessary. For TGF-beta receptors, hanging drop vapor diffusion methods have proven successful .

  • Crystal harvesting and analysis: Crystals must be carefully harvested and often flash-frozen in cryoprotectant solutions before diffraction analysis. X-ray diffraction data is typically collected at synchrotron radiation facilities .

A notable example from related research showed that mature TGF-beta2 crystallized in a different crystal form (space group P4₁2₁2) compared to previous structures, revealing a distinct dimeric conformation that would require significant rearrangement for receptor binding. This structural insight suggests a possible additional level of activity regulation once the latency-associated protein has been separated .

The structural solution was accomplished through maximum likelihood-scored molecular replacement, with final Eulerian angles and fractional cell coordinates (α, β, γ, x, y, and z) of 348.4, 21.1, 119.9, 0.127, 0.696, and -0.899 .

How does the interaction between TGFBR2 and TGFBR1 influence experimental design?

Understanding the complex interactions between TGFBR2 and TGFBR1 is critical for experimental design:

  • Co-expression studies: When investigating receptor function, consider co-expressing both TGFBR2 and TGFBR1 to recapitulate the natural signaling complex. Evidence suggests that these receptors form functional complexes upon ligand stimulation, and studying them in isolation may not fully capture their physiological roles .

  • Conditional knockout approaches: Genetic studies have shown both functional similarities and divergences between TGFBR2 and TGFBR1. For example, conditional deletion of either receptor in female reproductive tract using Amhr2-Cre leads to similar phenotypes, suggesting functional redundancy in this context .

  • Context-dependency considerations: In other tissues, such as vascular smooth muscle cells, neural crest cells, and cartilage, ablation of TGFBR2 or TGFBR1 can produce divergent phenotypes. This context-dependent behavior necessitates tissue-specific experimental design .

  • Simultaneous receptor deletion studies: To fully understand the interplay between these receptors, consider experimental designs that include single receptor deletions as well as simultaneous deletion of both TGFBR2 and TGFBR1 .

This understanding guides researchers to avoid assumptions about receptor redundancy and instead empirically determine the contextual interactions in their specific experimental system.

What functional assays can assess recombinant pig TGFBR2 activity?

Several functional assays can be employed to assess the activity of recombinant pig TGFBR2:

  • Ligand binding assays: Using labeled TGF-beta ligands to measure binding affinity and kinetics of recombinant TGFBR2. Surface plasmon resonance (SPR) or microscale thermophoresis can provide quantitative binding parameters .

  • Phosphorylation assays: Since TGFBR2 has intrinsic kinase activity, assessing its ability to phosphorylate downstream targets (including TGFBR1) can indicate functional activity. Western blotting with phospho-specific antibodies or in vitro kinase assays may be employed .

  • Reporter gene assays: Cells transfected with TGFBR2 and a Smad-responsive reporter construct can be used to measure signaling pathway activation upon ligand stimulation .

  • Cell proliferation assays: TGF-beta signaling often influences cell proliferation. The ED₅₀ (effective dose for 50% response) for TGF-beta effects on cell proliferation typically ranges from 0.03-0.18 ng/mL, providing a sensitive readout for receptor functionality .

  • Smad nuclear translocation: Immunofluorescence or cell fractionation approaches can be used to assess Smad2/3 nuclear translocation following receptor activation, a critical step in TGF-beta signaling .

These complementary approaches provide a comprehensive assessment of recombinant TGFBR2 functionality across multiple aspects of TGF-beta signaling.

How does glycosylation impact recombinant pig TGFBR2 function and experimental applications?

Glycosylation of TGFBR2 significantly influences its function and must be considered in experimental applications:

Understanding these glycosylation aspects ensures that experimental results with recombinant pig TGFBR2 accurately reflect physiological receptor function.

How can recombinant pig TGFBR2 be used to study disease mechanisms?

Recombinant pig TGFBR2 serves as a valuable tool for studying disease mechanisms:

  • Cardiovascular disease models: TGFBR2 mutations are associated with Marfan Syndrome type 2 (MFS2) and Loeys-Dietz Syndrome (LDS), characterized by aortic aneurysms and dissection. Recombinant TGFBR2 variants can be used to study how specific mutations alter receptor function, signaling, and interactions with TGFBR1 .

  • Cancer research applications: Decreased expression of TGFBR2 is associated with prostate cancer progression, while high TGFBR2 activity in lung cancer may correlate with tumor aggressiveness and immunotherapy resistance. Recombinant TGFBR2 can be employed in signaling pathway analyses and drug screening assays .

  • Reproductive system disorders: Studies using conditional knockout models have revealed that TGFBR2 is essential for maintaining structural integrity of the female reproductive tract. Recombinant TGFBR2 can help elucidate specific receptor-ligand interactions in reproductive tissues .

  • Comparative studies: Pig models often serve as useful translational bridges between mouse studies and human applications. Recombinant pig TGFBR2 can be particularly valuable for comparative studies across species, given the high degree of conservation in TGF-beta signaling components .

By utilizing recombinant pig TGFBR2 in these contexts, researchers can gain insights into disease mechanisms and potential therapeutic approaches targeting the TGF-beta signaling pathway.

What considerations are important when designing recombinant TGFBR2 constructs for different experimental applications?

Designing recombinant TGFBR2 constructs requires careful consideration of several factors:

  • Domain selection: TGFBR2 contains distinct functional domains including extracellular ligand-binding, transmembrane, and intracellular kinase domains. Depending on the experimental question, researchers may choose to express:

    • Full-length receptor (567 amino acids) for cellular studies

    • Extracellular domain only for ligand binding studies

    • Intracellular kinase domain for enzymatic and structural studies

  • Tagging strategies: Different tags offer specific advantages:

    • Histidine tags facilitate purification via nickel affinity chromatography

    • Strep tags provide highly specific purification with mild elution conditions

    • Fc fusion proteins can enhance stability and detection

    • Tag placement (N- vs C-terminal) may affect protein function and requires validation

  • Expression vector selection: Consider promoter strength, inducibility, and compatibility with the chosen expression system. For mammalian expression, vectors with CMV or EF1α promoters often yield high expression levels .

  • Codon optimization: Adaptation of the DNA sequence to the codon usage bias of the expression host can significantly improve protein yields .

  • Signal peptide selection: For secreted or membrane proteins, appropriate signal peptides ensure proper trafficking. Native signal sequences or well-characterized alternatives (e.g., IL-2 or tPA signal sequences) may be employed .

This methodological approach to construct design maximizes the likelihood of obtaining functional recombinant TGFBR2 suited to specific experimental applications.

What are the current challenges in studying TGFBR2-TGFBR1 complexes and how can they be addressed?

Studying TGFBR2-TGFBR1 complexes presents several challenges that require sophisticated approaches:

  • Transient nature of receptor interactions: The dynamic association between TGFBR2 and TGFBR1 upon ligand binding makes structural and functional studies challenging. Approaches to address this include:

    • Chemical crosslinking to stabilize complexes

    • Co-expression systems with bicistronic vectors

    • Fluorescence resonance energy transfer (FRET) for real-time interaction studies

  • Context-dependent signaling outcomes: The same receptor complex can produce different phenotypic outcomes in different tissues. Mixed results have been observed in vascular, neural crest, and reproductive tissues. Addressing this requires:

    • Tissue-specific conditional knockout models

    • Comparative studies across multiple tissues

    • Single-cell analysis to capture heterogeneous responses

  • Technical challenges in co-crystallization: Obtaining crystal structures of the complete TGFBR2-TGFBR1-ligand complex remains difficult. Strategies include:

    • Using stabilized receptor constructs

    • Nanobody-assisted crystallization

    • Cryo-electron microscopy as an alternative approach

  • Signaling pathway crosstalk: TGF-beta receptors participate in crosstalk with other signaling pathways, complicating the interpretation of experimental results. Solutions include:

    • Pathway-specific inhibitors to isolate TGF-beta effects

    • Phosphoproteomic analysis to map signaling networks

    • Systems biology approaches to model pathway interactions

By systematically addressing these challenges, researchers can gain deeper insights into the structure, function, and regulation of TGFBR2-TGFBR1 complexes in normal physiology and disease states.

How might new technologies advance recombinant TGFBR2 research?

Emerging technologies are poised to advance recombinant TGFBR2 research in several key areas:

  • CRISPR-Cas9 genome editing: Precise modification of endogenous TGFBR2 genes allows for:

    • Introduction of disease-associated mutations in cellular or animal models

    • Creation of reporter cell lines with fluorescently tagged TGFBR2

    • Domain-specific functional studies through targeted modifications

  • Single-molecule imaging techniques: These technologies enable visualization of receptor dynamics and interactions:

    • Total internal reflection fluorescence (TIRF) microscopy for membrane receptor clustering

    • Single-particle tracking for receptor movement and internalization

    • Super-resolution microscopy to resolve nanoscale receptor complexes

  • Protein structure prediction algorithms: Recent advances in AI-based structure prediction (e.g., AlphaFold) may help:

    • Model TGFBR2 structures in different conformational states

    • Predict effects of mutations on receptor structure

    • Guide rational design of TGFBR2 variants with altered function

  • Organoid and tissue-on-chip technologies: These systems provide more physiologically relevant contexts:

    • Testing TGFBR2 function in 3D tissue-like environments

    • Studying tissue-specific receptor functions

    • Evaluating therapeutic interventions targeting TGFBR2

These technological developments will enable more sophisticated studies of TGFBR2 structure, function, and regulation, potentially leading to new therapeutic approaches targeting TGF-beta signaling pathways.

What are the comparative aspects of pig TGFBR2 that make it valuable for translational research?

Pig TGFBR2 offers several advantages for translational research:

  • Evolutionary conservation: Mature porcine TGF-beta 2 shows 100% amino acid identity with human, dog, horse, and cow TGF-beta 2, and 97% amino acid identity with mouse and rat TGF-beta 2. This high degree of conservation suggests that pig TGFBR2 likely shares significant structural and functional similarity with human TGFBR2 .

  • Physiological similarities: Pig cardiovascular, pulmonary, and digestive systems share many anatomical and physiological features with humans. These similarities make pig models valuable for studying TGFBR2-related diseases such as aortic aneurysms and fibrotic disorders .

  • Glycosylation patterns: Pig cells produce glycosylation patterns more similar to humans than those of rodents, making recombinant pig TGFBR2 potentially more relevant for predicting human responses .

  • Translational applications: Several characteristics make pig TGFBR2 valuable for bridging basic research and clinical applications:

    • Size and scale more comparable to humans than mouse models

    • Potential for creating genetically modified pig models of TGFBR2-related diseases

    • Tissues suitable for xenotransplantation research

These comparative aspects position pig TGFBR2 as an important tool in translational research, potentially accelerating the development of therapies targeting TGF-beta signaling pathways in human diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.