Recombinant Pig Translocator protein (TSPO)-VLPs

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will ship in lyophilized form with normal blue ice packs by default. However, if you require shipping in liquid form, it must be shipped with dry ice. Please communicate with us in advance, as extra fees for dry ice and a dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receipt, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please inform us, and we will investigate its feasibility for development.
Synonyms
TSPO; BZRP; Translocator protein; Peripheral-type benzodiazepine receptor; PBR
Datasheet & Coa
Please contact us to get it.
Expression Region
1-169aa
Research Area
Cancer
Source
Mammalian cell
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Translocator protein (TSPO) facilitates the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, although its precise physiological function is debated. It appears not to be essential for steroid hormone biosynthesis. TSPO can bind protoporphyrin IX and may participate in the transport of porphyrins and heme. It was initially identified as the peripheral-type benzodiazepine receptor and can also bind isoquinoline carboxamides.
Gene References Into Functions
  1. PBR mRNA was more abundant in pig tissues and in warm kidney that underwent ischemia, suggesting functional implications of PBR during the renal repair process. PMID: 17019653
  2. Changes in TSPO expression in regenerating kidney tissue could be crucial for renal protection and the maintenance of kidney function. PMID: 19386723
Database Links
Protein Families
TspO/BZRP family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is Translocator protein (TSPO) and why is it significant for research?

Translocator protein (TSPO), formerly known as peripheral benzodiazepine receptor, is a transmembrane protein primarily located on the outer mitochondrial membrane (OMM) and predominantly expressed in glial cells within the brain. TSPO's significance stems from its close correlation with neuropathological conditions and its potential as both a biomarker and therapeutic target .

Methodologically, TSPO research approaches include:

  • Using TSPO-binding ligands such as PK11195 for positron emission tomography (PET) imaging to visualize neuroinflammation in conditions including Alzheimer's disease and Parkinson's disease

  • Investigating TSPO's role in critical mitochondrial functions including cholesterol transport, steroid hormone synthesis, mitochondrial permeability transition pore opening, and apoptosis

  • Developing pharmacological agents targeting TSPO for anti-inflammatory and neuroprotective purposes

Recent genetic studies have revealed contradictions between pharmacological and genetic approaches to studying TSPO, suggesting our understanding of this protein remains incomplete .

What are Virus-Like Particles (VLPs) and how are they utilized in vaccine development?

Virus-Like Particles (VLPs) are self-assembling protein structures that mimic the organization and conformation of authentic native viruses but lack the viral genome, making them non-infectious. In vaccine development, VLPs serve as delivery vehicles for presenting viral epitope antigens to the host immune system .

The methodological approach to VLP development involves:

  • Recombinant expression of viral structural proteins that spontaneously self-assemble into virus-resembling particles

  • Incorporation of specific antigenic epitopes from target pathogens into the VLP structure

  • Leveraging the polymeric nature of VLPs for repetitive antigen presentation, which effectively stimulates immune responses

For porcine virus research, hepatitis B virus core capsid protein (HBcAg) has been successfully used as a VLP backbone, forming an icosahedral capsid with 240 repeating units in a single assembled particle. By inserting epitope antigens from porcine pathogens such as PRRSV or PEDV into these particles, researchers can achieve multivalent antigen presentation .

What methodological advantages do VLP-based approaches offer over traditional vaccine strategies?

VLP-based approaches provide several methodological advantages over traditional vaccines, particularly modified live-attenuated vaccines (MLVs):

  • Enhanced Safety Profile: VLPs contain no viral genetic material, eliminating the risk of reversion to virulence that exists with MLVs . This makes VLPs ideal for studying immune responses without accidental infection risk.

  • Protein-Based Precision: Being purely protein-based, VLPs allow researchers to precisely control which antigenic components are presented to the immune system, enabling targeted immune response studies .

  • Adaptability to Viral Diversity: RNA viruses like PRRSV and PEDV exhibit substantial heterogeneity through mutations . VLP platforms can incorporate epitopes from multiple strains, potentially offering broader protection.

  • Repetitive Antigen Presentation: The structural arrangement of VLPs, with multiple copies of target antigens (up to 240 copies per particle in HBcAg-based VLPs), enhances immunogenicity through repetitive antigen display .

  • Experimental Flexibility: This platform allows systematic testing of different epitope combinations. For example, one mouse study evaluated four different VLP vaccine candidates incorporating various B-cell and T-cell epitopes from PRRSV structural proteins .

How does TSPO expression correlate with neuroinflammation in research models?

TSPO expression significantly increases in activated glial cells during neuroinflammation, making it a valuable marker for inflammatory responses in the central nervous system . The correlation between TSPO and neuroinflammation can be methodologically investigated through:

  • Expression Analysis: TSPO upregulation can be quantified using immunohistochemistry, PCR, or Western blotting in experimental neuroinflammation models .

  • PET Imaging Applications: Radio-labeled TSPO ligands enable non-invasive visualization of neuroinflammation in vivo, with binding affinity highly correlating with disease progression in conditions like Alzheimer's disease .

  • Correlation with Inflammatory Mediators: Research approaches often measure relationships between TSPO expression levels and the production of pro-inflammatory cytokines .

  • Microglial Activation Assessment: Since TSPO is predominantly expressed in glial cells, its upregulation serves as an indicator of microglial activation during neuroinflammatory responses .

What are the key considerations for epitope selection in VLP vaccine design?

Epitope selection is critical for effective VLP vaccine design, with several methodological considerations:

  • B-cell versus T-cell Epitope Balance: Effective designs incorporate both humoral and cellular immune response targets :

    • B-cell epitopes should be surface-accessible regions that can generate neutralizing antibodies

    • T-cell epitopes need to be processable by antigen-presenting cells and bind to MHC molecules

    • Successful PRRSV VLP studies have incorporated both types of epitopes for robust immune response

  • Epitope Length Optimization: Experimental determination of optimal epitope length is necessary:

    • Studies with PRRSV and PEDV incorporated epitopes ranging from 8 amino acids (748YSNIGVCK755 from PEDV) to 15 amino acids (117LAALICFVIRLAKNC131 from PRRSV)

    • Length affects both immunogenicity and VLP assembly integrity

  • Positioning Within VLP Structure: Strategic placement affects immune presentation:

    • Inserting epitopes at the immunodominant region of the carrier protein optimizes exposure

    • Flanking sequences may influence proper folding and accessibility

  • Cross-Protection Potential: Epitopes conserved across multiple strains may provide broader protection, as demonstrated by the GP3-4 VLP candidate that stimulated neutralizing responses against two distinct PRRSV strains .

What methodological challenges exist in incorporating TSPO epitopes into VLP constructs?

Incorporating TSPO epitopes into VLP constructs presents several sophisticated methodological challenges:

  • Membrane Protein Integration: TSPO is naturally a transmembrane protein, making its structural incorporation into VLPs challenging . Research approaches must:

    • Design fusion constructs that maintain TSPO's native conformation

    • Ensure proper folding and orientation within the VLP structure

    • Prevent aggregation due to hydrophobic domains

  • Epitope Selection Complexity: Determining effective TSPO epitope regions requires:

    • Immunogenic region identification through epitope mapping

    • Verification of surface accessibility on the VLP

    • Assessment of conservation across species and strains

  • Expression System Optimization: Recombinant expression of TSPO-VLP constructs requires:

    • E. coli expression systems may require codon optimization for efficient TSPO expression

    • Purification protocols must be adapted to handle the unique properties of TSPO-containing constructs

    • Expression yields may be affected by TSPO sequence inclusion

  • Structural Integrity Verification: Ensuring TSPO components don't disrupt VLP assembly requires:

    • Electron microscopy verification of particle formation

    • Dynamic light scattering to confirm appropriate particle size distribution

    • Stability testing under various storage conditions

  • Functional Assay Development: Verifying immunogenicity preservation requires:

    • Antibody binding studies to confirm epitope accessibility

    • In vitro systems to test immune cell activation

    • Animal models to assess immune response profiles

How can the contradictory findings about TSPO function be reconciled in experimental design?

Designing TSPO-VLP experiments requires carefully reconciling contradictory findings about TSPO function through several methodological approaches:

  • Multi-Method Validation: Recent research reveals discrepancies between pharmacological and genetic studies of TSPO , necessitating:

    • Parallel assessment using both pharmacological inhibitors and genetic knockdown/knockout

    • Verification across different experimental models (cell lines, primary cultures, animal models)

    • Systematic comparison of results obtained through different methodological approaches

  • Species-Specific Validation: TSPO function and ligand interactions differ between species , requiring:

    • Species-specific validation of TSPO epitopes selected for VLP incorporation

    • Comparative analysis between human, mouse, and pig TSPO

    • Recognition that "TSPO ligands may have different targets depending on species"

  • Context-Dependent Analysis: TSPO's roles vary with cell type and inflammatory state :

    • Cell-type specific evaluation before epitope selection

    • Assessment under different inflammatory conditions

    • Consideration that "depending on the grades of inflammation, correlations of TSPO with neuroinflammation should be interpreted with caution"

  • Ligand-Independent Evaluation: Evidence suggests TSPO ligands have targets beyond TSPO itself :

    • Verification that observed effects are specifically due to TSPO interaction

    • Potential value in incorporating both TSPO and its interacting partners

    • Recognition that "TSPO and its ligands have different mechanisms of action"

What experimental approaches are optimal for evaluating TSPO-VLP efficacy in porcine models?

Evaluating TSPO-VLP efficacy in porcine models requires comprehensive experimental approaches:

  • Immunogenicity Assessment Methods:

    • Serum antibody titer measurement through ELISA

    • Epitope-specific antibody analysis

    • T-cell response evaluation through ELISpot or intracellular cytokine staining

    • Cytokine profiling to characterize immune response signatures

  • Functional Neutralization Assays:

    • In vitro neutralization tests similar to those used for PRRSV vaccine candidates, where "mouse serum from one candidate GP3-4 was able to prevent infection of 2 distinct PRRSV strains in petri dishes"

    • Flow cytometry to assess binding of antibodies to cells expressing TSPO

    • Competitive binding assays to determine if antibodies interfere with TSPO ligand binding

  • Challenge Models with Relevant Readouts:

    • Clinical parameter monitoring including body temperature and symptom scoring

    • Viral load quantification in relevant tissues

    • Histopathological assessment of target organs

    • Survival rate analysis for lethal challenge models

  • Maternal-Neonatal Transfer Studies:

    • Pregnant gilt vaccination followed by neonatal piglet challenge, similar to the PEDV model where "the vaccine candidate was able to elicit significant viral neutralization antibody titer in gilt milk at 3 days post-farrowing (DPF), and provided nursing piglets with clinical relief"

    • Milk antibody titer measurement to assess passive immunity transfer

    • Correlation analysis between maternal antibody levels and piglet protection

How might TSPO polymorphisms affect VLP vaccine design and efficacy?

TSPO polymorphisms present significant considerations for VLP vaccine design and efficacy:

  • Binding Site Variations: Different TSPO polymorphisms affect ligand binding properties , requiring:

    • Characterization of binding site variations across populations

    • Selection of epitopes from conserved regions

    • Multiple epitope incorporation to address variant forms

  • Species and Strain Differences: TSPO exhibits functional differences between species :

    • Human versus porcine TSPO comparison to identify conserved functional domains

    • Selection of epitopes that recognize porcine-specific TSPO regions if targeting only pigs

    • Cross-species epitope selection if translational applications are desired

  • Affinity Testing Protocols: Methodological approaches must address binding variability:

    • Comparative binding assays with different TSPO variants

    • Affinity maturation of antibodies through iterative selection

    • Competition assays against natural TSPO ligands to assess functional impact

  • Population-Level Analysis: Understanding the distribution of TSPO polymorphisms in target populations:

    • Sequencing studies to identify prevalent TSPO variants in pig populations

    • Correlation analysis between polymorphisms and vaccine response

    • Potential for personalized vaccine approaches based on TSPO genotyping

  • Functional Impact Assessment: Determining how polymorphisms affect TSPO function:

    • Mitochondrial function assays across different TSPO variants

    • Steroidogenesis capacity variation between polymorphisms

    • Neuroinflammatory response differences based on TSPO variant expression

What dual targeting strategies could enhance TSPO-VLP efficacy against porcine diseases?

Dual targeting strategies could significantly enhance TSPO-VLP efficacy through methodological approaches that combine multiple mechanisms of action:

  • TSPO-Pathogen Epitope Co-display: VLPs can simultaneously present TSPO epitopes and pathogen-specific epitopes :

    • Similar to successful approaches with PRRSV where both GP3 and GP5 epitopes were incorporated

    • Enables targeting of both host inflammatory response and direct pathogen neutralization

    • Requires optimization of epitope ratios and positioning within the VLP structure

  • TSPO-Immunomodulator Combinations: Leveraging TSPO's role in inflammation :

    • Incorporation of anti-inflammatory cytokine genes or peptides alongside TSPO epitopes

    • Sequential immune activation and modulation targeting

    • Temporal control of inflammatory response during infection

  • Multi-Cellular Targeting Strategy: Addressing different cell types involved in disease:

    • Targeting TSPO on microglia/macrophages for neuroinflammatory modulation

    • Incorporating epitopes targeting endothelial cells for vascular effects

    • Developing constructs that address both direct infection and secondary inflammation

  • Maternal-Neonatal Protection Approach: Building on successful gilt vaccination strategies :

    • Optimizing TSPO-VLPs for transplacental and milk antibody transfer

    • Designing constructs that elicit prolonged maternal immunity

    • Balancing epitopes for optimal passive transfer to neonates

  • Heterologous Prime-Boost Strategy: Enhancing protection through sequential immunization:

    • Initial priming with TSPO-VLPs followed by pathogen-specific VLP boost

    • Combination with traditional vaccines for enhanced protection

    • Methodological assessment of timing between prime and boost for optimal efficacy

Comparative Analysis of TSPO and VLP Research Components

ParameterTSPOVLP Platform (HBcAg-based)Potential TSPO-VLP Application
Cellular LocationOuter mitochondrial membrane Self-assembles into particles Targeting mitochondrial function
Expression SystemNaturally in glial cells Recombinant E. coli expression Recombinant production
StructureTransmembrane protein Icosahedral capsid with 240 repeats Multiple TSPO epitope display
Primary FunctionCholesterol transport, steroidogenesis Antigenic epitope presentation Immunomodulation targeting
Disease RelevanceNeuroinflammation biomarker Vaccine development platform Neuroinflammatory disease targeting
Species DifferencesSignificant human vs. rodent differences Adaptable to multiple species Requires species-specific validation
Validation ChallengesPharmacological vs. genetic study discrepancies Epitope selection optimization Multiple validation approaches needed

Successful VLP Vaccine Development Strategies for Porcine Viruses

Virus TargetEpitopes UsedVLP BackboneAnimal ModelKey FindingsPotential Application to TSPO
PRRSVB-cell: 61QAAIEVYEPGRS72 and 89ELGFVVPPGLSS100; T-cell: 117LAALICFVIRLAKNC131 and 149KGRLYRWRSPVIIEK163 HBcAgMiceCandidate GP3-4 stimulated significant viral neutralizing response against two PRRSV strains Similar epitope selection strategy from TSPO
PEDVB-cell: 748YSNIGVCK755 HBcAgPregnant gilts and neonatal pigletsSignificant viral neutralization antibody titer in gilt milk; provided nursing piglets with clinical relief Maternal vaccination strategy for TSPO-targeting

TSPO Ligands and Their Potential Application to TSPO-VLP Design

TSPO LigandGenerationBinding SpecificityApplicationLimitationsRelevance to TSPO-VLP Design
PK11195FirstOriginal standard ligandPET imaging of neuroinflammation High non-specific binding Target epitopes near the PK11195 binding site
Ro5-4864FirstTemperature and species dependent Early PET imaging Binding affinity affected by temperature and species Consider species differences in epitope selection
SSR180575SecondHigher imaging contrast than PK11195 Improved neuroinflammation detection Binds to targets other than TSPO (e.g., hCAR) Multiple validation techniques needed

What emerging technologies could advance TSPO-VLP research?

The next generation of TSPO-VLP research could benefit from several emerging methodological approaches:

  • CRISPR/Cas9 Gene Editing: Precise genetic modification allows:

    • Creation of pig models with modified TSPO expression or function

    • Development of cell lines expressing variant TSPO forms for screening

    • Targeted humanization of porcine TSPO for translational studies

  • Single-Cell Analysis Technologies: Understanding cellular heterogeneity through:

    • Single-cell RNA sequencing to profile TSPO expression across cell populations

    • Mass cytometry to correlate TSPO levels with cellular activation states

    • Spatial transcriptomics to map TSPO expression in tissue contexts

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy to visualize TSPO-VLP structures at near-atomic resolution

    • Hydrogen-deuterium exchange mass spectrometry to study TSPO conformation changes

    • Advanced epitope mapping to identify optimal binding regions

  • Systems Biology Approaches:

    • Multi-omics integration to understand TSPO within broader cellular networks

    • Computational modeling of TSPO-mediated inflammatory responses

    • Network analysis to identify optimal multi-target approaches

  • Advanced Delivery Technologies:

    • Mucosal delivery systems for enhanced VLP presentation

    • Time-released formulations for optimal immune stimulation

    • Targeted delivery to specific tissue or cell types

How should contradictory findings about TSPO guide future experimental design?

Future experimental designs addressing TSPO should incorporate the following methodological considerations to reconcile contradictory findings:

  • Multi-Level Validation Strategy:

    • "To advance the field further, we need to understand the differences between the actions of ligands and of the protein itself"

    • Parallel assessment using both TSPO ligands and genetic manipulation

    • Integration of findings from different experimental systems

  • Species-Specific Approach:

    • "Recent studies indicate that increased TSPO binding sites in human PET imaging has implications different from those of increased TSPO expression in rodents"

    • Systematic comparison of porcine, human, and rodent TSPO

    • Development of species-specific research tools and assays

  • Context-Dependent Evaluation:

    • "Depending on the grades of inflammation, correlations of TSPO with neuroinflammation should be interpreted with caution"

    • Standardized inflammation grading in experimental models

    • Multi-parameter assessment of inflammatory states

  • Broader Target Perspective:

    • "TSPO ligands may have different targets depending on species"

    • Proteomics approaches to identify all binding partners

    • Phenotypic screening to capture full spectrum of effects

  • Replication and Reproducibility Focus:

    • Independent validation across multiple laboratories

    • Standardized protocols and reporting

    • Pre-registration of experimental designs to minimize bias

What are the most promising near-term applications for TSPO-VLP research?

The most promising near-term applications for TSPO-VLP research lie at the intersection of diagnostic development, targeted immunomodulation, and novel vaccine approaches. The unique combination of TSPO's role as a neuroinflammation biomarker with the highly immunogenic presentation platform of VLPs creates opportunities for both veterinary and translational applications.

VLP technology has already demonstrated success in porcine disease models, with candidate vaccines showing promising results against both PRRSV and PEDV . The extension to TSPO-targeting could provide novel approaches to addressing neuroinflammatory components of porcine diseases while simultaneously developing platforms with potential translational applications to human neurological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.