Recombinant Pig Transmembrane and coiled-coil domains protein 1 (TMCO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines. Shipping is standard with blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMCO1; Calcium load-activated calcium channel; CLAC channel; Transmembrane and coiled-coil domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
TMCO1
Target Protein Sequence
MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS
Uniprot No.

Target Background

Function
TMCO1 (Transmembrane and coiled-coil domains protein 1) is a calcium-selective channel crucial for preventing calcium store overload and maintaining calcium homeostasis. In response to endoplasmic reticulum (ER) stress, TMCO1 assembles into a homotetrameric calcium channel, regulating ER calcium levels. It is also a component of the ribosome-associated ER translocon complex, involved in the translocation of multi-pass membrane proteins into the ER membrane and their biogenesis. Specifically, TMCO1, along with SEC61 and TMEM147, forms a lipid-filled cavity within the translocon. TMEM147 may insert hydrophobic segments of multi-pass membrane proteins from the lumen into this central membrane cavity, a process regulated by SEC61. TMCO1 may similarly insert hydrophobic segments from the cytosol into the cavity.
Database Links
Protein Families
TMCO1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, with high levels in liver, kidney and heart, intermediate amounts in back fat, longissimus dorsi, brain, lymph, large intestine, small intestine and lung, and low levels in spleen and stomach.

Q&A

What is the basic structure of porcine TMCO1?

Porcine TMCO1 is encoded by a 567 base pair open reading frame (ORF) that translates into a 188 amino acid protein. The protein belongs to the DUF841 superfamily of eukaryotic proteins. Unlike its human counterpart, porcine TMCO1 has been demonstrated to localize specifically to the mitochondrion as verified through confocal fluorescence microscopy techniques . The protein contains characteristic transmembrane and coiled-coil domains that are essential for its function in forming calcium channels when assembled as tetramers.

What is the primary function of TMCO1?

TMCO1 primarily functions as a calcium channel protein that regulates calcium homeostasis within cellular compartments. In humans, TMCO1 is located in the endoplasmic reticulum (ER) membrane where it forms specialized channel structures through which calcium ions flow. When calcium levels in the ER become excessive, four TMCO1 proteins assemble to create a functional channel that releases the excess calcium into the cytoplasm . This calcium regulation is critical for numerous cellular processes including cell growth, division, and gene activity. The proper balance of these ions is essential for the development and function of various tissues and organs, particularly bone, brain, and eye tissues.

How does tissue expression of TMCO1 vary in pigs?

Tissue expression analysis has revealed that porcine TMCO1 is not uniformly expressed across all tissues. It shows particularly high expression levels in the liver, kidney, and heart . This differential expression pattern suggests tissue-specific roles for TMCO1 in pigs, which may reflect its importance in metabolically active organs that require precise calcium regulation. Understanding these expression patterns provides insight into potential tissue-specific functions that may be relevant for comparative studies or when using porcine models for human disease research.

What is the role of TMCO1 in bone development and osteoporosis?

TMCO1 plays a critical role in osteogenesis through calcium-dependent signaling pathways. Research has demonstrated significantly decreased TMCO1 levels in bone specimens from both osteoporosis patients and osteoporotic mice models . Mechanistically, TMCO1-mediated calcium leak from the ER provides local calcium signals that activate the CaMKII-HDAC4-RUNX2 signaling axis, which is essential for proper bone formation. In TMCO1-deficient mice, decreased HDAC4 phosphorylation results in nuclear enrichment of HDAC4, leading to deacetylation and degradation of RUNX2, the master regulator of osteogenesis . These mice exhibit characteristic osteoporotic phenotypes including decreased bone volume/total volume (BV/TV), reduced bone mineral density (BMD), decreased trabecular thickness (Tb.Th), and increased trabecular spacing (Tb.Sp). This positions TMCO1 as a potential therapeutic target for osteoporosis treatment strategies.

How is TMCO1 implicated in cancer pathogenesis?

TMCO1 has been identified as a significant factor in multiple cancer types, with particularly strong evidence in gliomas and ovarian cancer:

In gliomas:

  • TMCO1 is upregulated and its overexpression correlates with poor prognosis

  • Expression levels associate with WHO grade classification of gliomas

  • Knockdown experiments demonstrate that reducing TMCO1 inhibits proliferation and induces apoptosis in U87 and U251 glioma cell lines

  • TMCO1 promotes glioblastoma cell migration and invasion by enhancing epithelial-mesenchymal transition (EMT)

In ovarian cancer:

  • TMCO1 expression significantly differs between ovarian cancer tissue and normal tissue, correlating with survival rates

  • TMCO1 overexpression associates with lymph node metastases, late FIGO stage, and larger tumor size

  • It promotes proliferation, calcium ion elevation, cytoskeletal remodeling, and metastasis in both cisplatin-sensitive (SK-OV-3) and cisplatin-resistant (SK-OV-3-CDDP) ovarian cancer cells

  • TMCO1 regulates multiple cancer-associated proteins including VDAC1, CALR, Vimentin, N-cadherin, and β-catenin

These findings suggest TMCO1 could serve as both a prognostic biomarker and potential therapeutic target in multiple cancer types.

What genetic disorders are associated with TMCO1 mutations?

Mutations in the TMCO1 gene are associated with cerebro-facio-thoracic dysplasia, a rare genetic disorder characterized by severe intellectual disability, distinctive facial features, and skeletal abnormalities primarily affecting the ribs and vertebrae. At least four TMCO1 gene mutations have been identified that cause this condition . These mutations typically result in premature truncation of the TMCO1 protein, leading to rapid degradation. Without functional TMCO1, calcium channels cannot form properly, causing calcium accumulation in the ER. This disrupts the development of various tissues and organs, particularly affecting brain development and craniofacial structures .

Additionally, genetic variations in TMCO1 or in regulatory regions controlling its expression are associated with primary open-angle glaucoma, a common cause of vision loss worldwide . This further underscores the diverse physiological roles of TMCO1 in different tissues.

What are the optimal approaches for recombinant expression of porcine TMCO1?

For successful recombinant expression of porcine TMCO1, researchers should consider:

  • Expression System Selection:

    • Prokaryotic systems (E. coli): Suitable for high yield but may require optimization for proper folding of transmembrane domains

    • Eukaryotic systems (insect cells, mammalian cells): Better for preserving native conformation and post-translational modifications

  • Construct Design:

    • Include the complete 567 bp ORF encoding the 188 amino acid protein

    • Consider adding purification tags (His, GST) at N-terminus to avoid interfering with C-terminal transmembrane domains

    • Include appropriate Kozak sequence for efficient translation initiation

  • Optimization Parameters:

    • Temperature: Lower temperatures (16-20°C) often improve folding of membrane proteins

    • Induction conditions: IPTG concentration (0.1-1.0 mM) for bacterial systems

    • Expression time: 16-24 hours typically yields optimal balance between expression and toxicity

  • Verification Methods:

    • Western blotting with anti-TMCO1 antibodies

    • Mass spectrometry for confirmation of full-length expression

    • Subcellular localization confirmation using confocal microscopy

What methodologies are effective for studying TMCO1-mediated calcium regulation?

Several approaches have proven effective for investigating TMCO1's role in calcium homeostasis:

  • Calcium Imaging Techniques:

    • Fluo-4 AM fluorescent calcium indicator for real-time monitoring of cytosolic calcium levels

    • Genetically encoded calcium indicators (GECIs) like GCaMP for targeted organelle calcium measurement

    • Dual-wavelength ratiometric imaging to quantify absolute calcium concentrations

  • Electrophysiological Methods:

    • Patch-clamp recordings of TMCO1 channel activity

    • Single-channel recordings to characterize conductance properties

    • Store-operated calcium entry (SOCE) measurements to assess ER calcium store regulation

  • Genetic Manipulation Approaches:

    • CRISPR/Cas9-mediated knockout models to assess calcium homeostasis in TMCO1-deficient cells

    • Overexpression studies using wild-type and mutant TMCO1 constructs

    • siRNA or shRNA knockdown for transient suppression of TMCO1 expression

  • Functional Assays:

    • ER calcium store depletion with thapsigargin followed by calcium imaging

    • Calcium-dependent signaling pathway analysis (CaMKII phosphorylation, NFAT translocation)

    • Analysis of downstream effectors using phospho-specific antibodies for CaMKII and HDAC4

How can researchers effectively model TMCO1 deficiency in experimental systems?

Researchers can employ several approaches to model TMCO1 deficiency:

  • In Vitro Models:

    • siRNA/shRNA-mediated transient knockdown in relevant cell lines

    • CRISPR/Cas9-generated stable knockout cell lines

    • Expression of dominant-negative TMCO1 mutants

  • In Vivo Models:

    • Whole-organism knockout mice through targeted gene deletion

    • Tissue-specific conditional knockout using Cre-loxP systems

    • CRISPR/Cas9-generated porcine models for translational research

  • Key Phenotypic Analyses:

    • Calcium homeostasis assessment using fluorescent indicators

    • Bone formation parameters: bone volume (BV/TV), bone mineral density (BMD), trabecular thickness (Tb.Th)

    • Cellular proliferation and apoptosis assays

    • Skeletal analysis through micro-CT imaging

    • Gene expression profiling of downstream targets like RUNX2

  • Validation Approaches:

    • Rescue experiments through reintroduction of wild-type TMCO1

    • Comparison with patient-derived samples harboring TMCO1 mutations

    • Cross-species validation to confirm conserved functions

How do researchers resolve the apparent discrepancy in TMCO1 subcellular localization between species?

The localization discrepancy between human TMCO1 (endoplasmic reticulum) and porcine TMCO1 (mitochondrion) presents an intriguing research challenge . To address this apparent contradiction, researchers should consider:

  • Methodological Validation:

    • Employ multiple subcellular fractionation techniques

    • Use diverse antibodies targeting different epitopes to eliminate antibody specificity issues

    • Implement dual-labeling with established organelle markers

    • Validate findings using both overexpressed tagged constructs and endogenous protein detection

  • Isoform Analysis:

    • Investigate potential alternative splicing of TMCO1 that might generate isoforms with different localizations

    • Perform comparative genomic analysis of TMCO1 across species

    • Characterize species-specific post-translational modifications that might affect localization

  • Experimental Approaches:

    • Super-resolution microscopy (STORM, PALM) for precise subcellular localization

    • Proximity labeling techniques (BioID, APEX) to identify organelle-specific interaction partners

    • Time-course analysis to detect potential translocation between organelles under different conditions

    • Cross-species expression studies to determine if localization is protein-intrinsic or context-dependent

What are the critical considerations for translating TMCO1 research to therapeutic applications?

Researchers pursuing therapeutic applications based on TMCO1 modulation should address:

  • Target Validation Considerations:

    • Confirm TMCO1's role across multiple model systems

    • Establish clear dose-response relationships in modulating calcium homeostasis

    • Determine tissue-specific functions and potential off-target effects

    • Validate findings in patient-derived samples when possible

  • Therapeutic Strategy Development:

    • For osteoporosis: Approaches to enhance TMCO1 expression or activity in osteoblasts

    • For cancer: Methods to inhibit TMCO1 expression or function in tumor cells

    • For genetic disorders: Gene therapy approaches to restore TMCO1 function

  • Delivery Challenges:

    • Achieving tissue-specificity given TMCO1's widespread expression

    • Developing methods to target intracellular membrane proteins

    • Designing small molecules that can modulate channel activity versus protein expression

  • Preclinical Validation Requirements:

    • Efficacy testing in relevant disease models

    • Pharmacokinetic/pharmacodynamic studies

    • Toxicity assessment with special attention to calcium homeostasis in off-target tissues

    • Biomarker development to monitor treatment response

What are the most promising techniques for studying TMCO1 structure-function relationships?

Understanding TMCO1's structure-function relationship is critical for developing targeted interventions. Researchers should consider:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for near-atomic resolution of TMCO1 tetramers

    • X-ray crystallography of individual domains or stabilized full-length protein

    • NMR spectroscopy for dynamic structural information

    • Molecular dynamics simulations to predict conformational changes during channel formation

  • Functional Mapping Techniques:

    • Alanine scanning mutagenesis to identify critical residues

    • Domain swapping to determine specific functions of transmembrane versus coiled-coil domains

    • FRET-based approaches to monitor conformational changes during channel activation

    • Cross-linking studies to capture transient interaction states

  • Channel Function Analysis:

    • Liposome reconstitution assays for purified protein

    • Calcium flux measurements in reconstituted systems

    • Single-molecule imaging to observe tetramer assembly

    • Patch-clamp electrophysiology with site-directed mutants

  • Interaction Mapping:

    • Proximity labeling to identify context-specific interaction partners

    • Co-immunoprecipitation studies combined with mass spectrometry

    • Yeast two-hybrid screening for novel interactors

    • Comparative interactome analysis across different tissues and species

How does TMCO1 expression correlate with disease progression across different pathologies?

DiseaseTMCO1 Expression PatternClinical CorrelationReference
GliomaUpregulatedCorrelates with WHO grade and poor prognosis
Ovarian CancerUpregulatedAssociated with lymph node metastases, late FIGO stage, larger tumors
OsteoporosisDownregulatedLinked to decreased bone mass and altered microarchitecture
Cerebro-facio-thoracic dysplasiaLoss of function (mutation)Results in developmental abnormalities
Primary open-angle glaucomaGenetic variationsContributes to increased risk of glaucoma development

This comparative analysis reveals a complex relationship between TMCO1 dysfunction and disease, with both overexpression and underexpression associated with pathological conditions depending on the tissue context.

What experimental models are most appropriate for different TMCO1 research questions?

Research FocusRecommended In Vitro ModelsRecommended In Vivo ModelsKey ReadoutsTechnical Considerations
Calcium HomeostasisHEK293, Primary osteoblastsConditional knockout miceCalcium imaging, CaMKII phosphorylationMaintain physiological calcium conditions during experiments
Bone DevelopmentMC3T3-E1, Primary osteoblastsTMCO1-/- miceμCT analysis, bone formation rates, RUNX2 activityAge-matched controls critical for developmental studies
Cancer BiologyU87, U251 (glioma), SK-OV-3 (ovarian)Xenograft tumor modelsProliferation, invasion, EMT markersConsider both TMCO1 overexpression and knockdown models
Genetic DisordersPatient-derived fibroblastsKnock-in mice with patient mutationsDevelopmental milestones, skeletal analysisFocus on developmental timepoints relevant to disease onset

This framework provides researchers with guidance for selecting appropriate experimental systems based on their specific research questions related to TMCO1 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.