Recombinant Pig Transmembrane protein 14A (TMEM14A)

Shipped with Ice Packs
In Stock

Description

Role in Kidney Function

TMEM14A is critical for maintaining the glomerular filtration barrier. Key studies include:

  • Proteinuria Prevention: Knockdown in zebrafish embryos induced proteinuria, while overexpression in diseased kidneys (e.g., glomerulonephritis) correlates with barrier protection .

  • Podocyte-Specific Expression: Localized to podocytes, TMEM14A interacts with slit diaphragm proteins to prevent albumin leakage .

Oncogenic Role in Ovarian Cancer

TMEM14A exhibits pro-tumorigenic effects in ovarian cancer:

  • Cell Cycle Regulation: Overexpression upregulates Cyclin D1, Cyclin E, and PCNA, promoting G1/S transition .

  • Invasion Pathways: Silencing TMEM14A reduces MMP-2 and MMP-9 expression, impairing metastasis .

  • TGF-β Signaling: Modulates Smad2/3 phosphorylation, linking TMEM14A to TGF-β-driven tumor progression .

PathwayEffect of TMEM14A KnockdownMolecular MarkersSource
Cell CycleG1/S arrest, reduced proliferation↓ Cyclin D1, E; ↓ PCNA
MetastasisSuppressed invasion↓ MMP-2, MMP-9
ApoptosisEnhanced (in non-cancer contexts)↑ Bax activation

Antibody Validation

Control fragments (e.g., aa 39–58) are used to block antibodies (e.g., PA5-67246) in immunohistochemistry (IHC) and Western blot (WB) .

Mechanistic Insights

  • Apoptosis Regulation: Recombinant TMEM14A inhibits mitochondrial outer membrane permeabilization, suppressing apoptosis .

  • Structural Studies: Limited due to its small size and membrane-bound nature, though cell-free expression systems enable partial purification .

Challenges and Future Directions

  • Functional Redundancy: Overlapping roles with other TMEM proteins complicate targeted studies.

  • Therapeutic Potential: Dual roles in kidney protection and cancer progression necessitate context-specific interventions.

  • Structural Elucidation: Cryo-EM or NMR studies are needed to resolve TMEM14A’s interactions with Bax or slit diaphragm proteins.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM14A; Transmembrane protein 14A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
TMEM14A
Target Protein Sequence
MDLIGFGYAALVTFGSILGYKRRGGVPSLIAGLFVGFLAGYGAYRVSLDKRDVKLSLFTA FFLATIMGVRFKRSKKIMPAGLVAGLSLLMILRLVLLLL
Uniprot No.

Target Background

Function
Inhibits apoptosis by negatively regulating the mitochondrial outer membrane permeabilization involved in the apoptotic signaling pathway.
Database Links

KEGG: ssc:100512176

UniGene: Ssc.2842

Protein Families
TMEM14 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane.

Q&A

What is the basic structure of pig TMEM14A and how does it compare to other species?

TMEM14A is a 99-amino acid integral membrane protein containing three transmembrane domains. Its structure has been identified through nuclear magnetic resonance spectroscopy, revealing a compact arrangement of alpha-helical transmembrane segments . While specific pig TMEM14A structural data is limited, comparative analysis with human and rat orthologs shows high conservation of transmembrane domains, suggesting similar structural organization across mammalian species.

The protein's small size and multiple membrane-spanning regions create significant challenges for recombinant expression and purification. Researchers should note that the hydrophobic nature of these transmembrane regions can lead to protein aggregation during expression in heterologous systems.

What are the known functions of TMEM14A in porcine cellular processes?

TMEM14A has been implicated in several critical cellular functions:

  • Prevention of apoptosis through suppression of Bax-mediated loss of mitochondrial membrane potential

  • Maintenance of glomerular filtration barrier integrity

  • Possible involvement in podocyte survival mechanisms

Expression patterns in rat models suggest TMEM14A levels decrease before the onset of proteinuria, indicating its potential role as a protective factor in renal function . Experimental evidence from zebrafish models demonstrates that knocking down tmem14a mRNA translation results in proteinuria without affecting tubular reabsorption, further supporting its role in maintaining glomerular barrier function .

What expression systems are most effective for producing functional recombinant pig TMEM14A?

Multiple expression systems can be utilized for recombinant TMEM14A production, each with distinct advantages:

Expression SystemAdvantagesConsiderations for TMEM14A
E. coliRapid growth, high yield, cost-effectiveMay require optimization for membrane protein folding; often produces inclusion bodies requiring refolding
YeastPost-translational modifications, membrane protein machineryBetter for maintaining transmembrane protein structure than bacterial systems
Mammalian cellsNative-like folding and modificationsLower yields but potentially better functionality; preferred for structural studies
Insect cellsHigh expression levels for membrane proteinsBalance between yield and proper folding; good compromise option

How can transmembrane domain insertion be optimized during recombinant expression?

Proper membrane insertion of TMEM14A's three transmembrane domains presents a significant challenge. Optimization strategies include:

  • Using specialized E. coli strains designed for membrane protein expression

  • Employing fusion partners that enhance membrane targeting (e.g., MBP for periplasmic targeting)

  • Modifying growth conditions (temperature reduction to 16-20°C after induction)

  • Supplementing with specific lipids that facilitate membrane protein folding

  • Utilizing directed evolution approaches to select for variants with improved expression

Temperature modulation is particularly important, as lower temperatures slow protein synthesis and can allow more time for proper membrane insertion, potentially reducing aggregation and misfolding.

How do different fusion tags affect TMEM14A expression and function?

The choice of fusion tag significantly impacts recombinant TMEM14A expression and functionality:

Tag TypeImpact on TMEM14ABest Application
His-TagMinimal size impact, good for purificationInitial purification steps via Ni-NTA chromatography
FLAG-TagSmall size, good antibody detectionImmunodetection and co-immunoprecipitation studies
GFPEnables direct visualization, large sizeLocalization studies, protein folding assessment
MBPEnhances solubility, large sizeImproving solubility of difficult-to-express constructs

When designing GFP-tagged TMEM14A constructs for visualization studies, researchers should consider that GFP insertion could potentially disrupt the transmembrane topology . Placing GFP at either terminus rather than within loop regions may preserve protein structure and function better.

What are effective strategies for visualizing TMEM14A localization in cells?

For cellular localization studies, researchers can employ recombinant TMEM14A with fluorescent protein tags:

  • Generate a TMEM14A-GFP fusion construct with the reporter gene positioned to minimize disruption of transmembrane domains

  • Establish stable expression in relevant cell lines (e.g., kidney cell lines for studying glomerular function)

  • Confirm expression using Western blot analysis with antibodies against both TMEM14A and the tag

  • Perform co-localization studies with organelle markers (mitochondria, ER, plasma membrane)

  • Validate localization patterns using immunofluorescence with TMEM14A-specific antibodies

When analyzing microscopy data, careful assessment of expression levels is crucial as overexpression can lead to artifacts in protein localization. The cytopathic effect observed in some recombinant protein expression systems should be monitored, as seen in viral expression systems .

What purification strategies are most effective for recombinant TMEM14A?

Purifying transmembrane proteins like TMEM14A requires specialized approaches:

  • Initial extraction: Use appropriate detergents (DDM, LDAO, or digitonin) to solubilize membrane fractions

  • Affinity chromatography: Utilize Ni-NTA chromatography for His-tagged constructs

  • Refolding protocols: For proteins expressed in inclusion bodies, employ gradual dialysis against decreasing urea concentrations to promote proper refolding

  • Size exclusion chromatography: Remove aggregates and ensure monodispersity

  • Detergent exchange: Transition to milder detergents for functional studies

Recovery rates following purification and refolding can approach 90% under optimized conditions, as demonstrated with other recombinant proteins . For TMEM14A, particular attention should be paid to maintaining the integrity of transmembrane domains during purification.

How can the structural integrity of purified recombinant TMEM14A be verified?

Multiple analytical techniques can assess structural integrity:

  • Circular dichroism spectroscopy: Evaluate secondary structure content, particularly alpha-helical content expected in transmembrane domains

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Determine oligomeric state and homogeneity

  • Limited proteolysis: Assess compact folding and domain organization

  • Fluorescence-based thermal shift assays: Measure protein stability in different buffer conditions

  • Nuclear magnetic resonance (NMR) spectroscopy: Provide detailed structural information for smaller transmembrane proteins like TMEM14A

What assays can demonstrate the anti-apoptotic function of recombinant TMEM14A?

Based on TMEM14A's reported role in preventing Bax-mediated apoptosis , researchers can employ these functional assays:

  • Mitochondrial membrane potential measurement: Using fluorescent dyes (TMRM, JC-1) to assess TMEM14A's effect on maintaining mitochondrial integrity

  • Cytochrome c release assays: Determining whether TMEM14A expression prevents cytochrome c translocation from mitochondria to cytosol

  • Caspase activation assays: Measuring effector caspase activity in cells with and without TMEM14A expression

  • Annexin V/PI staining: Quantifying apoptotic cell populations by flow cytometry

  • Direct interaction studies: Using pulldown assays or proximity ligation assays to study TMEM14A-Bax interactions

When designing these experiments, include appropriate controls such as known anti-apoptotic proteins (Bcl-2 family members) and ensure consistent expression levels across experimental conditions.

How can researchers assess TMEM14A's role in glomerular filtration barrier integrity?

To investigate TMEM14A's function in maintaining the glomerular filtration barrier , researchers can employ:

  • Knockout/knockdown models:

    • siRNA or morpholino-based knockdown in cell culture

    • CRISPR/Cas9-mediated knockout in relevant cell lines

    • Zebrafish tmem14a knockdown model as established in previous research

  • Transwell permeability assays: Measuring albumin or other protein passage across monolayers of podocytes with variable TMEM14A expression

  • Proteinuria assessment in animal models: Analyzing urinary protein content in models with modulated TMEM14A expression

  • Immunohistochemistry: Evaluating TMEM14A expression in glomeruli across different disease states and correlating with barrier integrity markers

  • Electron microscopy: Assessing ultrastructural changes in podocyte foot processes and slit diaphragms when TMEM14A expression is altered

How does copy number influence recombinant TMEM14A expression in transgenic systems?

Based on studies with other transgenic models, TMEM14A expression levels correlate with transgene copy number . Key considerations include:

  • Copy number determination: Use absolute quantitative real-time PCR to accurately determine transgene copy number in your expression system

  • Expression correlation: Higher copy numbers generally correlate with increased expression, but this relationship is not always linear due to:

    • Positional effects of integration

    • Potential silencing mechanisms

    • Promoter competition

  • Expression stability: Monitor expression across multiple passages to assess stability, as transgene expression can decrease over time even with stable copy numbers

  • Inheritance patterns: In transgenic animal models, evaluate expression patterns across generations to understand stability of inheritance

What role does promoter methylation play in recombinant TMEM14A expression?

Promoter methylation significantly impacts transgene expression stability . For recombinant TMEM14A:

  • Methylation analysis: Use bisulfite sequencing to determine methylation levels of the promoter driving TMEM14A expression

  • Correlation studies: Higher methylation levels generally correlate with reduced transgene expression

  • Temporal changes: Monitor methylation patterns over time, as increased passages or aging can lead to progressive methylation and silencing

  • Demethylating agents: Consider using 5-azacytidine or similar agents to reverse methylation-induced silencing if expression decreases over time

Researchers should note that CMV promoters, commonly used in recombinant expression systems, are particularly susceptible to methylation-induced silencing over time .

What are common challenges in expressing recombinant TMEM14A and their solutions?

ChallengePossible CausesSolutions
Low expression yieldProtein toxicity, codon bias, mRNA instabilityOptimize codon usage, use inducible promoters, lower induction temperature
Protein aggregationImproper membrane insertion, overexpressionUse fusion partners (MBP, SUMO), optimize detergent selection, reduce expression rate
Incorrect foldingInadequate chaperones, rapid expressionCo-express with chaperones, add chemical chaperones to media, slow expression rate
DegradationProteolytic activity, instabilityAdd protease inhibitors, use protease-deficient host strains, optimize purification speed
Poor solubilityHydrophobic transmembrane domainsOptimize detergent selection, use nanodiscs or amphipols for stabilization

When troubleshooting expression issues, implement systematic changes to one variable at a time while maintaining detailed records of conditions and outcomes.

How can researchers address protein aggregation during TMEM14A purification?

For transmembrane proteins like TMEM14A with multiple hydrophobic domains, aggregation during purification is a common issue. Strategies to minimize aggregation include:

  • Detergent screening: Test multiple detergents (DDM, LDAO, FC-12, digitonin) at various concentrations to identify optimal solubilization conditions

  • Buffer optimization: Include glycerol (10-15%) and adjust ionic strength to stabilize the protein

  • Temperature control: Maintain samples at 4°C throughout purification process

  • Lipid addition: Supplement with specific lipids that may stabilize the native conformation

  • Alternative solubilization systems: Consider styrene maleic acid lipid particles (SMALPs) or nanodiscs for maintaining a lipid environment around the protein

  • Refolding protocols: For proteins purified from inclusion bodies, implement stepwise dialysis with gradually decreasing denaturant concentrations, similar to methods used for other recombinant proteins

How can pig TMEM14A be studied in the context of renal disease models?

TMEM14A's role in maintaining glomerular filtration barrier integrity makes it relevant for renal disease research:

  • Expression analysis in disease states:

    • Compare TMEM14A expression levels in healthy vs. diseased kidney tissues

    • Track temporal changes in expression during disease progression

    • Correlate expression levels with disease severity markers

  • Therapeutic potential investigation:

    • Test whether increasing TMEM14A expression can restore barrier function

    • Develop peptide mimetics of functional TMEM14A domains

    • Identify compounds that can modulate TMEM14A activity or expression

  • Comparative species studies:

    • Compare pig TMEM14A function with human and rodent orthologs

    • Assess species-specific differences in regulation and interaction partners

Research in rat models has shown that TMEM14A expression decreases before the onset of proteinuria and remains consistently lower in disease states compared to controls . This temporal relationship suggests TMEM14A may serve as both a biomarker and therapeutic target.

What are the approaches for investigating TMEM14A interactions with other proteins?

To elucidate TMEM14A's molecular mechanism of action, interaction studies are essential:

  • Co-immunoprecipitation: Using tagged recombinant TMEM14A to pull down interaction partners from cellular lysates

  • Proximity-based labeling: Employing BioID or APEX2 fusions to identify proteins in close proximity to TMEM14A in living cells

  • Yeast two-hybrid membrane system: Modified for membrane proteins to screen for direct interactors

  • Mass spectrometry-based interactomics: Combining affinity purification with LC-MS/MS to identify binding partners

  • FRET/BRET assays: For studying dynamic interactions in live cells, particularly with suspected partners like Bax

When investigating TMEM14A interactions with Bax specifically, researchers should design experiments that can distinguish between direct binding and indirect functional relationships, as this interaction may be central to TMEM14A's anti-apoptotic function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.