Recombinant Pig Transmembrane protein 173 (TMEM173)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pig Transmembrane Protein 173 (TMEM173), also known as Stimulator of Interferon Genes (STING), is a critical mediator of innate immune responses. It functions as a cytosolic DNA sensor, activating type I interferon (IFN) pathways during infections by pathogens such as viruses and bacteria. The recombinant form is engineered for research applications, enabling studies on porcine immunology, viral pathogenesis, and therapeutic development.

Expression Systems and Production

Recombinant Pig TMEM173 is typically produced in E. coli with a His-tag for purification .

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His-tag
Protein LengthFull-length (1-378 amino acids)
Purity>90% (verified by SDS-PAGE)
Storage-20°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water or glycerol solution (50% recommended for long-term storage)

Biochemical Properties

  • Molecular Weight: ~42 kDa (calculated) .

  • Stability: Stable for 12 months at -20°C; sensitive to repeated freeze-thaw cycles .

  • Applications:

    • SDS-PAGE analysis .

    • Functional studies on DNA sensing and immune evasion mechanisms .

ASFV Immune Evasion Mechanisms

African Swine Fever Virus (ASFV) exploits Pig TMEM173 to suppress host immunity:

ASFV ProteinTargetMechanismOutcome
L83LSTINGPromotes STING degradationInhibits IFN-β production
MGF505-7RSTINGBlocks STING traffickingReduces IRF3 phosphorylation
EP364RcGAMPCompetes with STING for cGAMP bindingAttenuates IFN signaling

These findings highlight recombinant Pig TMEM173’s utility in studying host-pathogen interactions and antiviral drug development.

Comparative Analysis with Other Species

FeaturePig TMEM173Human TMEM173Bovine TMEM173
Amino Acids378379378
Key DomainsCBD, transmembraneCBD, transmembraneCBD, transmembrane
Immune RoleASFV defenseViral/bacterial defenseViral/bacterial defense
Expression HostE. coliHEK293T, E. coliE. coli

Pig TMEM173 shares >85% sequence homology with human and bovine variants but exhibits species-specific pathogen interactions .

Future Directions

Recombinant Pig TMEM173 is pivotal for:

  • Developing STING-targeted therapies against ASFV.

  • Engineering immunocompetent porcine models for vaccine testing.

  • Elucidating structural determinants of STING activation across species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
STING1; TMEM173; Stimulator of interferon genes protein; poSTING; Transmembrane protein 173
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MPYSSLHPSIPQPRGLRAQVAALVLLGACLVALWGLGELPEYTLRWLVLHLASQQIGLLV KGLCSLAEELCHVHSRYQSSYWRAARACLGCPIRCGALLLLSCYFYFSIRDKAGLPLPWM LALLGLSQALNILLGLQHLAPAEVSAICEKRNFNVAHGLAWSYYIGYLRLILPGLRARIQ AYNQRHKNVLGGIGNHRLHILFPLDCGVPDDLSVADPNIRFLHELPQQSADRAGIKGRVY TNSIYELLENGQPAGVCVLGYATPLQTLFAMSQDGRAGFSREDRLEQAKLFCRTLEDILA DAPEAQNNCRLIVYQEPTEGGSFSLSQEILRHLRQEEREVTMGSAETSVVPTSSTLSQEP ELLISGMEQPLPLRSDIF
Uniprot No.

Target Background

Function
STING1 (Stimulator of Interferon Genes) is a key facilitator of innate immune signaling, acting as a sensor of cytosolic DNA from bacteria and viruses. It promotes the production of type I interferon (IFN-alpha and IFN-beta). The innate immune response is triggered by non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. STING1 recognizes and binds to cyclic dinucleotides: specifically, it binds cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA viruses in the cytosol. Upon binding c-di-GMP or cGAMP, STING1 oligomerizes, translocates from the endoplasmic reticulum, and is phosphorylated by TBK1 on the pLxIS motif. This phosphorylation leads to the recruitment and activation of the transcription factor IRF3, inducing the expression of type I interferon and establishing a potent antiviral state. In addition to promoting type I interferon production, STING1 plays a direct role in autophagy. After cGAMP binding, STING1 buds from the endoplasmic reticulum into COPII vesicles, forming the endoplasmic reticulum-Golgi intermediate compartment (ERGIC). The ERGIC serves as the membrane source for WIPI2 recruitment and LC3 lipidation, leading to the formation of autophagosomes that target cytosolic DNA or DNA viruses for degradation by the lysosome. The autophagy- and interferon-inducing activities can be uncoupled, and autophagy induction is independent of TBK1 phosphorylation. Autophagy is also triggered upon infection by bacteria. Following c-di-GMP binding, which is produced by live Gram-positive bacteria, STING1 promotes reticulophagy. STING1 exhibits 2',3' phosphodiester linkage-specific ligand recognition. It can bind both 2'-3' linked cGAMP (2'-3'-cGAMP) and 3'-3' linked cGAMP but is preferentially activated by 2'-3' linked cGAMP. The preference for 2'-3'-cGAMP, compared to other linkage isomers, is likely due to the ligand's organized free-ligand conformation, which resembles the STING1-bound conformation and requires minimal energy to transition into the active conformation. STING1 may be involved in translocon function, potentially influencing the induction of type I interferons. It may also be involved in transducing apoptotic signals through its association with the major histocompatibility complex class II (MHC-II).
Gene References Into Functions
  1. the cloning and characterization of porcine STING (poSTING) PMID: 20346968
Database Links
Protein Families
TMEM173 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at higher level in the spleen, lymph node, lung and bone marrow, followed by the small intestine, heart, liver and brain, and to a lesser extent in the stomach and kidney.

Q&A

What is Recombinant Pig TMEM173 and how does it function in immune signaling?

Recombinant Pig TMEM173/STING is a synthetically produced version of the endogenous porcine transmembrane protein that functions as a critical adaptor in cytosolic DNA sensing pathways. Structurally, it's characterized as a transmembrane protein that resides in the endoplasmic reticulum membrane. When activated by cyclic dinucleotides (such as cGAMP produced by cyclic GMP-AMP synthase or cGAS), TMEM173 undergoes conformational changes that trigger downstream signaling cascades, ultimately leading to type I interferon production and proinflammatory cytokine expression. In porcine models, TMEM173 serves as an essential component in defense against intracellular pathogens, particularly DNA viruses and certain bacteria .

What expression systems are commonly used for producing Recombinant Pig TMEM173?

Recombinant Pig TMEM173 can be produced using several expression systems, each with distinct advantages depending on research requirements. Common production platforms include E. coli, yeast, baculovirus-infected insect cells, mammalian cell expression systems, and cell-free expression systems. While E. coli systems offer high yield and cost-effectiveness, they may lack appropriate post-translational modifications. Mammalian cell systems (typically HEK293 or CHO cells) provide more native-like modifications but at higher production costs. Cell-free expression systems offer rapid production with reduced contamination risks. The choice of expression system significantly impacts protein folding, functionality, and experimental applications, with most commercial preparations achieving ≥85% purity as determined by SDS-PAGE .

What are the optimal storage and handling conditions for Recombinant Pig TMEM173?

For optimal stability and activity retention, Recombinant Pig TMEM173 should be stored at -80°C for long-term storage or at -20°C with cryoprotectants (such as 10% glycerol) for medium-term storage. Repeated freeze-thaw cycles should be strictly avoided, as they can significantly compromise protein integrity. When handling the protein, maintain a cold chain workflow using ice or refrigeration. The recommended working buffer typically contains 20-50 mM Tris-HCl (pH 7.5-8.0), 100-150 mM NaCl, and potentially low concentrations of reducing agents to maintain disulfide bonds. Importantly, if studying functional activation, avoid buffers containing high concentrations of DTT or β-mercaptoethanol, as these can disrupt structural integrity required for proper ligand binding .

What assay methods are recommended for analyzing Recombinant Pig TMEM173 activity?

Several robust methodological approaches are available for assessing Recombinant Pig TMEM173 activity. Functional assays typically measure downstream signaling events such as IRF3 phosphorylation or nuclear translocation using phospho-specific antibodies in Western blot or immunofluorescence applications. Reporter cell lines containing interferon-stimulated response elements (ISRE) driving luciferase expression provide quantitative readouts of pathway activation. For direct binding assays, microscale thermophoresis or isothermal titration calorimetry can determine binding affinities between TMEM173 and cyclic dinucleotide ligands. Additionally, ELISA-based methods can quantify interferon production following TMEM173 activation in cellular systems. When establishing these assays, include appropriate positive controls (such as synthetic cGAMP) and negative controls (pathway inhibitors or inactive protein mutants) .

How can researchers verify the quality and activity of Recombinant Pig TMEM173 preparations?

Quality verification of Recombinant Pig TMEM173 should follow a multi-parameter approach. Begin with purity assessment via SDS-PAGE and staining methods (Coomassie or silver staining), aiming for ≥85% purity as standard. Western blot using TMEM173/STING-specific antibodies confirms protein identity. For tertiary structure integrity, circular dichroism spectroscopy can identify proper folding patterns. Functional verification should include ligand binding assays using fluorescently labeled cyclic dinucleotides and a downstream signaling assay measuring IRF3 phosphorylation or type I interferon induction in a relevant cell line. Additionally, mass spectrometry can confirm molecular weight and evaluate potential post-translational modifications that might impact activity. Activity should be compared against a reference standard of known concentration and potency to establish relative activity units .

How do various cyclic dinucleotides differentially activate Recombinant Pig TMEM173?

Recombinant Pig TMEM173 responds to various cyclic dinucleotides with distinct activation profiles and affinities. The canonical mammalian ligand 2'3'-cGAMP (produced by cGAS) typically exhibits the highest affinity and activation potential, while bacterial cyclic dinucleotides (c-di-GMP, c-di-AMP, 3'3'-cGAMP) demonstrate variable potency depending on concentration. When designing activation experiments, researchers should consider ligand concentration curves (typically 0.1-100 μM) and time-course analyses (30 minutes to 24 hours) to fully characterize activation kinetics. Structural studies suggest that different cyclic dinucleotides induce subtly different conformational changes in TMEM173, potentially resulting in varied downstream signaling intensities or patterns. This differential activation may provide important insights into species-specific pathogen responses in porcine models versus other species .

What post-translational modifications affect Recombinant Pig TMEM173 function?

Several post-translational modifications (PTMs) critically influence TMEM173 function. Palmitoylation at conserved cysteine residues affects membrane localization and is essential for proper signaling. Phosphorylation events, particularly at serine residues in the C-terminal tail, modulate activation threshold and signal duration. Ubiquitination regulates protein turnover and can attenuate signaling. When working with recombinant TMEM173, researchers should consider that expression system choice significantly impacts PTM profiles - mammalian expression systems typically provide more physiologically relevant modifications than bacterial systems. Methodologically, site-directed mutagenesis of potential PTM sites combined with functional assays can help determine the importance of specific modifications. Mass spectrometry approaches (particularly LC-MS/MS) can identify and quantify PTMs present in recombinant preparations .

How can researchers effectively detect dimerization and conformational changes in Recombinant Pig TMEM173?

Dimerization and conformational changes are essential for TMEM173 activation and can be detected using several complementary approaches. For dimerization assessment, crosslinking methods using membrane-permeable crosslinkers (such as disuccinimidyl suberate) followed by non-reducing SDS-PAGE can visualize dimeric species. Förster resonance energy transfer (FRET) between differentially tagged TMEM173 constructs provides real-time measurements of protein proximity in live cells. Conformational changes can be monitored using limited proteolysis, which exposes differential cleavage patterns between active and inactive states. More advanced techniques include hydrogen-deuterium exchange mass spectrometry to map regions with altered solvent accessibility upon activation. For high-resolution analysis, single-molecule FRET combined with total internal reflection fluorescence microscopy can capture transient conformational intermediates during the activation process .

What strategies are effective for studying species-specific differences between Recombinant Pig TMEM173 and other mammalian orthologs?

Investigating species-specific differences requires multi-faceted comparative approaches. Begin with sequence alignment analysis to identify divergent residues, followed by homology modeling based on available crystal structures. Create chimeric constructs by swapping domains between porcine and other species' TMEM173 (typically human or mouse) to identify regions responsible for functional differences. Employ comparative ligand binding assays using isothermal titration calorimetry or surface plasmon resonance to determine differential binding affinities across species. Functional comparison can utilize reporter cell lines from different species transfected with porcine TMEM173, measuring interferon response elements activation. For deeper mechanistic insights, CRISPR/Cas9-mediated gene replacement studies can swap endogenous TMEM173 with the porcine version in human or mouse cells to observe altered pathway responses in a whole-cell context .

How can Recombinant Pig TMEM173 be utilized in virus-host interaction studies?

Recombinant Pig TMEM173 serves as a valuable tool for understanding porcine virus-host interactions, particularly for economically important diseases like porcine reproductive and respiratory syndrome (PRRS), classical swine fever, and African swine fever. Methodologically, researchers can employ competitive binding assays between viral DNA/RNA and TMEM173 to determine if pathogen nucleic acids directly activate the STING pathway. Co-immunoprecipitation studies using recombinant TMEM173 can identify viral proteins that interact with STING, potentially revealing immune evasion strategies. For cellular studies, reconstitution of TMEM173-knockout cell lines with recombinant porcine TMEM173 followed by viral challenge allows observation of pathway-specific responses. Time-course experiments measuring TMEM173 activation, dimerization, and downstream signaling during infection provide insights into viral antagonism of this pathway. These approaches help identify potential therapeutic targets for treating porcine viral diseases .

What are the most effective approaches for identifying novel Recombinant Pig TMEM173 interacting partners?

Identification of novel TMEM173 interacting partners requires comprehensive protein-protein interaction discovery methodologies. Affinity purification-mass spectrometry (AP-MS) using recombinant pig TMEM173 as bait protein can capture physiological protein complexes. Include both resting state and activated state (cGAMP-bound) conditions to identify context-specific interactions. The BioID proximity labeling method, where TMEM173 is fused to a biotin ligase, allows identification of transient or weak interactions within the native cellular environment. Yeast two-hybrid screening, though less physiological, can identify direct binding partners from porcine cDNA libraries. For validation, reciprocal co-immunoprecipitation experiments with candidate interactors, followed by functional studies using siRNA knockdown or CRISPR knockout of putative partners, determine biological relevance. Confocal microscopy with fluorescently tagged proteins can confirm co-localization in relevant cellular compartments. These approaches together provide a network view of TMEM173's regulatory interactome .

What are common pitfalls when working with Recombinant Pig TMEM173 and how can they be addressed?

Several technical challenges commonly arise when working with Recombinant Pig TMEM173. Protein aggregation during storage or thawing can be mitigated by including low concentrations of non-ionic detergents (0.01-0.05% Tween-20) in storage buffers and avoiding rapid temperature changes. Inconsistent activation results often stem from variable ligand quality or degradation—researchers should use fresh, high-purity cyclic dinucleotides stored with minimal freeze-thaw cycles. For cellular assays, low transfection efficiency in porcine cells can be improved using optimized nucleofection protocols or lipid-based reagents specifically designed for primary cells. Interfering endogenous STING activity can confound results; consider using CRISPR-edited STING-knockout cell lines reconstituted with recombinant protein. Additionally, post-translational modification variability between recombinant protein batches may affect activity—thoroughly characterize each lot and maintain consistent sourcing when possible .

How can researchers overcome solubility and stability issues when purifying Recombinant Pig TMEM173?

Solubility and stability challenges are common with membrane proteins like TMEM173. For improved solubility during purification, consider expressing the cytosolic domain only (lacking transmembrane regions) or using fusion partners like maltose-binding protein (MBP) or SUMO that enhance solubility while preserving function. If full-length protein is required, optimize detergent selection through systematic screening of non-ionic (DDM, LMNG), zwitterionic (CHAPS), and mild (digitonin) detergents at various concentrations. For stability enhancement, supplement buffers with glycerol (5-10%), reducing agents (1-5 mM DTT or TCEP), and protease inhibitor cocktails. Consider nanodiscs or amphipols as membrane mimetics for maintaining native-like environments during functional studies. Ion exchange chromatography followed by size exclusion chromatography in optimized buffer conditions can separate aggregated from properly folded protein. For long-term storage, flash-freeze aliquots in liquid nitrogen and store at -80°C with cryoprotectants to minimize activity loss .

What controls should be included in experiments studying Recombinant Pig TMEM173 activation?

Robust experimental design for TMEM173 activation studies requires a comprehensive set of controls. Positive controls should include synthetic 2'3'-cGAMP at established concentrations (typically 1-10 μM) known to activate TMEM173, and poly(I:C) for parallel innate immune pathway activation comparison. Negative controls should incorporate inactive TMEM173 mutants (particularly those with alterations in the cGAMP binding pocket), heat-inactivated protein preparations, and TMEM173 pathway inhibitors such as H-151 or C-178. Include vehicle controls matching the solvent composition of your activating ligands. For cellular experiments, TMEM173-knockout cells serve as excellent negative controls, while cells overexpressing wild-type TMEM173 provide positive controls. Time-course controls are essential, as TMEM173 activation follows distinct temporal patterns with early (IRF3 phosphorylation, 30-60 minutes) and late (interferon production, 4-24 hours) events. All experiments should be performed with biological triplicates at minimum to account for variability .

How should researchers interpret species-specific differences when translating findings from Recombinant Pig TMEM173 to human applications?

When translating findings between porcine and human TMEM173 systems, researchers must systematically account for species-specific variations. First, establish direct functional comparisons using equivalent assays (e.g., dose-response curves to identical ligands) to quantify activation threshold differences. Consider evolutionary context through phylogenetic analysis to determine if differences represent adaptive immune specializations. For drug development applications, create comparison tables documenting binding affinities of compounds to both porcine and human TMEM173, focusing on correlation coefficients between species. When discrepancies arise, examine amino acid differences in binding pockets using structural modeling. Statistical approaches should include Bland-Altman plots to visualize systematic differences between species responses. Finally, validation in human primary cells or humanized mouse models provides critical transitional evidence before clinical application. These systematic comparisons help determine when porcine models provide relevant human translational insights versus when species-specific biology predominates .

What statistical approaches are most appropriate for analyzing TMEM173 activation data?

Statistical analysis of TMEM173 activation data requires careful consideration of the experimental design and data characteristics. For dose-response experiments, nonlinear regression models (typically four-parameter logistic curves) should be used to determine EC50 values and Hill coefficients, providing quantitative comparisons between different conditions. Time-course experiments benefit from repeated measures ANOVA with appropriate post-hoc tests to identify significant activation timepoints. For comparing multiple treatment groups, one-way ANOVA followed by Tukey's or Dunnett's tests (comparing to control) is appropriate after confirming normality assumptions. Non-parametric alternatives (Kruskal-Wallis followed by Dunn's test) should be employed when normality cannot be assumed. Power analysis prior to experimentation helps determine appropriate sample sizes, typically aiming for 80% power at α=0.05. For complex experimental designs with multiple variables, consider mixed-effects models to account for both fixed and random effects. Finally, visualization through principal component analysis can help identify patterns in multivariate TMEM173 pathway activation profiles .

What emerging technologies could advance Recombinant Pig TMEM173 research?

Several cutting-edge technologies are poised to transform TMEM173 research. Cryo-electron microscopy advancements now enable high-resolution structural analysis of TMEM173 in various activation states, potentially revealing species-specific conformational dynamics. AlphaFold2 and related computational approaches offer new opportunities for in silico prediction of protein-protein interactions and drug binding sites specific to porcine TMEM173. Single-cell techniques, particularly scRNA-seq combined with CITE-seq (for surface protein quantification), can reveal cell-type-specific TMEM173 activation patterns within heterogeneous porcine tissues. Organoid technologies derived from porcine tissues provide physiologically relevant 3D models for studying TMEM173 function in tissue-specific contexts. CRISPR-based genetic screens (both knockout and activation) in porcine cells can identify novel regulators of the TMEM173 pathway. Finally, advanced imaging techniques such as super-resolution microscopy and correlative light-electron microscopy offer unprecedented visualization of TMEM173 trafficking and localization during immune activation .

How might Recombinant Pig TMEM173 research contribute to understanding comparative immunology across species?

Comparative immunology studies utilizing Recombinant Pig TMEM173 provide unique evolutionary insights into innate immune adaptation. Pigs represent an important intermediate model between mice and humans in terms of immune system similarity, making them valuable for comparative studies. Methodologically, parallel analysis of TMEM173 activation across multiple species (porcine, human, murine, bovine) using identical stimulation conditions and readouts can identify conserved versus divergent signaling nodes. Multi-species pathway reconstruction through cross-species complementation experiments helps determine functional conservation despite sequence divergence. Genomic approaches examining selection pressure on TMEM173 across species can identify regions under positive selection, potentially representing adaptations to species-specific pathogens. Additionally, comparing TMEM173 pathway components across livestock species has particular relevance for agricultural diseases and zoonotic infection understanding. These comparative approaches collectively contribute to a more comprehensive model of innate immune evolution and help identify both broadly applicable and species-restricted therapeutic approaches targeting this pathway .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.