Recombinant Pig Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant pig AGTR1 is synthesized using heterologous expression platforms to ensure proper folding and post-translational modifications:

  • Common Systems:

    • Mammalian cell lines (e.g., HEK293) for native-like glycosylation .

    • E. coli for cost-effective production of antigenic fragments .

  • Validation Methods:

    • Western blotting using monoclonal antibodies (e.g., CSB-RA257443A0HU) confirms ~41 kDa bands in Hela, Raji, and MCF-7 cell lysates .

    • Functional assays (e.g., ligand-binding studies) validate angiotensin II affinity .

Functional Roles in Physiology and Disease

AGTR1 mediates angiotensin II’s vasoconstrictive and pro-fibrotic effects via:

  • Signal Transduction: Activation of PI3K/Akt and MAPK pathways, influencing cell proliferation and inflammation .

  • Pathophysiological Roles:

    • Xenotransplantation: Pig AGTR1 maintains residual renin-angiotensin-aldosterone system (RAAS) activity in baboon recipients, stabilizing blood pressure post-kidney transplantation .

    • Hepatic Function: Localizes at hepatocyte tight junctions, modulating bile flow and portal hypertension .

    • Cardiovascular Disease: Dysregulation linked to hypertension and heart failure in porcine models .

Research Applications and Detection Tools

Recombinant pig AGTR1 is pivotal in developing diagnostic and therapeutic tools:

Table 2: Key Detection Kits and Reagents

ProductApplicationSensitivity RangeSample TypeSource
Porcine AGTR1 ELISA KitQuantitative measurement0.16–10 ng/mLSerum, plasma, cell lysate
Anti-AGTR1 Antibody (66415)Western blot, immunohistochemistry1:2,000 dilutionTissue sections, lysates

Key Research Findings

  • Xenotransplantation Studies: Pig AGTR1 retains partial RAAS functionality in baboons, with measurable angiotensin II levels (10.3 ± 1.6 pg/mL) post-transplant, suggesting compensatory mechanisms .

  • Liver Pathophysiology: AGTR1 localizes at hepatocyte tight junctions, where angiotensin II increases permeability, exacerbating cholestasis and fibrosis .

  • Therapeutic Targeting: AGTR1 blockers (e.g., losartan) reduce renal fibrosis by modulating macrophage phagocytosis in rodent models, highlighting cross-species relevance .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your desired format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes a 50% glycerol final concentration, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please let us know, and we will prioritize its development for your order.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MILNSSTEDSIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICLAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSENGSSSTKKSAPCTEVE
Uniprot No.

Target Background

Function
The angiotensin II type 1 receptor (AT1R) acts as a receptor for angiotensin II. It mediates the effects of angiotensin II by coupling with G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Luminal ANG II is internalized as a complex with AT1R/AT2R heterodimers to target endoplasmic reticulum in LLC-PK1 cells, where it might trigger intracellular calcium responses. PMID: 28468964
  2. These studies offer insight into kidney biology by providing the first in vivo/in vitro experimental evidence about AT(1)R regulation in response to reduced kidney perfusion. PMID: 18172054
  3. AT1 and AT2 receptors heterodimerize and are involved in the angiotensin II effect on SERCA in proximal kidney tubules. PMID: 22218590
  4. A critical role for lipid raft microdomains in AGTR1-mediated signal transduction in neonatal glomerular mesengial cells. PMID: 24662198
  5. AT1 receptors are positively coupled to the proliferative response of vascular smooth muscle cells to angiotensin II. PMID: 21622819

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of pig AGTR1 and how does it compare to human AGTR1?

Pig AGTR1, like its human counterpart, is a G protein-coupled receptor with seven transmembrane domains. The human AGTR1 is 359 amino acids in length with a predicted molecular weight of 41.1 kDa . While specific pig AGTR1 sequence data isn't fully detailed in the provided sources, comparative studies indicate high conservation between species, as human AGTR1 shares 94% and 95% amino acid sequence identity with mouse and rat orthologs respectively . Based on this conservation pattern, pig AGTR1 likely has similar high homology to the human version.

Unlike rodents, which express two related genes (AGTR1A and AGTR1B), most species including pigs express a single AGTR1 gene . This makes pigs potentially better translational models for human AGTR1-related studies than rodent models in certain research contexts.

What are the primary physiological functions mediated by AGTR1 in pigs?

AGTR1 mediates most of the physiological actions of Angiotensin II across species, including:

  • Vasoconstriction

  • Aldosterone and vasopressin release

  • Salt and water retention

  • Cell proliferation and migration

  • Sympathetic stimulation

These functions are particularly important in cardiovascular regulation and renal physiology . In pigs specifically, AGTR1 plays a critical role in renovascular hypertension development and progression, making it an important research target for understanding hypertension pathophysiology .

What expression systems are most effective for producing recombinant pig AGTR1?

Based on recombinant human AGTR1 production methods, prokaryotic expression in E. coli represents a viable approach for producing recombinant pig AGTR1 . The human recombinant AGTR1 protocol includes:

  • Prokaryotic expression in E. coli

  • Production with N-terminal His Tag (typically Met1~Ile124)

  • Formulation in PBS (pH 7.4) containing 0.01% SKL and 5% Trehalose

  • Final product as freeze-dried powder with >90% purity

For pig AGTR1, researchers should consider similar methodologies while accounting for potential species-specific modifications to optimize expression and functionality. It's worth noting that membrane proteins like AGTR1 can present specific challenges in expression systems, potentially requiring detergent solubilization and careful refolding protocols.

What are the optimal storage and stability conditions for recombinant pig AGTR1?

Recombinant AGTR1 stability is typically maintained under the following conditions, which should be applied to pig AGTR1 preparations :

  • Reconstitution in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL

  • Avoid vortexing to prevent protein denaturation

  • Short-term storage at 2-8°C for up to one month

  • Long-term storage requires aliquoting and keeping at -80°C for up to 12 months

  • Avoiding repeated freeze/thaw cycles is critical for maintaining activity

Thermal stability data for recombinant human AGTR1 shows less than 5% degradation when incubated at 37°C for 48 hours, suggesting reasonable stability under proper storage conditions .

How can recombinant pig AGTR1 be used in radioligand binding studies?

Radioligand binding studies represent a powerful approach for AGTR1 characterization and have been successfully implemented in pig models. The methodology includes:

  • Preparation of appropriate radioligand (e.g., [11C]KR31173 as described in pig studies)

  • Determination of binding parameters in tissue samples or with purified recombinant protein

  • Analysis through deconvolution of time-activity curves

  • Quantification via retention of impulse response function (typically 80-minute retention)

In pig models of renovascular hypertension, radioligand binding showed significantly increased retention in hypoperfused kidneys (median 0.225, range: 0.150-0.373) compared to controls (0.142, range: 0.096-0.156), with P=0.044 . This demonstrates the utility of this approach in analyzing AGTR1 regulation under pathophysiological conditions.

What techniques are available for validating recombinant pig AGTR1 activity and specificity?

Multiple validation approaches are recommended:

  • Biochemical validation:

    • SDS-PAGE for molecular weight confirmation

    • Western blotting using specific antibodies

    • Isoelectric focusing (predicted pI for human AGTR1 is 8.3, similar values expected for pig)

  • Functional validation:

    • Angiotensin II binding assays

    • Downstream signaling activation (Ca2+ mobilization, MAPK activation)

    • Inhibition studies with selective antagonists

  • Specificity confirmation:

    • Competitive binding with known AGTR1 ligands

    • Inhibition with specific inhibitors like MLN-4760

    • Cross-reactivity assessment with related receptors

How do pig AGTR1 expression patterns compare to those in humans and other model organisms?

AGTR1 expression patterns across species show both similarities and differences:

  • In humans, AGTR1 is widely expressed with highest levels in liver, kidney, adrenal glands, brain, heart, vasculature, and lungs

  • Pig AGTR1 distribution follows similar patterns, with particularly important expression in renal tissue

  • Unlike rodents with two AGTR1 genes (AGTR1A and AGTR1B), pigs express a single AGTR1 gene, making them more similar to humans in this aspect

This similarity in expression pattern enhances the translational value of pig models for human cardiovascular and renal disease research.

What are the advantages of using pig models over rodent models for AGTR1 research?

Pig models offer several advantages over rodent models for AGTR1 research:

  • Genetic similarity: Pigs express a single AGTR1 gene like humans, whereas rodents express two related genes (AGTR1A and AGTR1B)

  • Physiological relevance: Pig cardiovascular and renal physiology more closely resembles human physiology

  • Translational value: Findings in pig models may translate more directly to human applications, particularly for pharmacological interventions

  • Pathophysiological modeling: Pig models of renovascular hypertension have been established and characterized, allowing for detailed study of AGTR1 regulation under disease conditions

  • Size advantage: The larger size of pigs enables more detailed physiological measurements and tissue sampling

How can PET imaging with AGTR1 radioligands advance renovascular disease research?

Position Emission Tomography (PET) imaging targeting AGTR1 represents an advanced research application with significant translational potential:

  • Studies using radioligand [11C]KR31173 in pig models of renovascular hypertension have demonstrated:

    • Increased binding in hypoperfused kidneys

    • Correlation between in vivo PET findings and in vitro autoradiography

    • Persistence of increased binding despite ACE inhibitor treatment (lisinopril)

  • This approach provides unique insights into:

    • AT1R regulation in response to reduced kidney perfusion

    • Potential compensatory mechanisms under pathological conditions

    • Differences between pharmacological intervention and receptor expression

  • Translational implications include:

    • Development of AT1R PET as a diagnostic biomarker for renovascular disease

    • Potential for monitoring treatment response

    • Non-invasive assessment of receptor regulation in living subjects

What role does AGTR1 play in the angiotensin cleavage pathway, and how can recombinant models help elucidate this?

The angiotensin pathway involves complex regulation with AGTR1 playing a central role:

  • Pathway overview:

    • Angiotensin I is converted to Angiotensin II by ACE

    • Angiotensin II binds to AGTR1 to exert its primary physiological effects

    • Angiotensin II can be further metabolized to Ang-(1-7) by ACE2

  • Regulatory mechanisms:

    • Recombinant ACE2 (rACE2) can efficiently cleave Angiotensin II to form Ang-(1-7)

    • This cleavage is blocked by specific ACE2 inhibitors like MLN-4760

    • The disappearance of Ang I over time is slower and less affected by ACE2 inhibition

  • Research applications:

    • Using recombinant pig AGTR1 in binding studies with Angiotensin II in the presence/absence of rACE2

    • Investigating receptor regulation under different concentrations of ligand

    • Studying cross-talk between AGTR1 and other components of the RAS system

What antibodies and detection methods are recommended for pig AGTR1 studies?

Several approaches can be employed for detecting and studying pig AGTR1:

  • Antibody options:

    • Polyclonal antibodies raised against specific AGTR1 epitopes (e.g., AA 263-359)

    • Cross-reactive antibodies validated for multiple species

  • Detection applications:

    • Western blotting for protein expression quantification

    • Immunohistochemistry for tissue localization

    • Immunocytochemistry for cellular distribution

    • Immunoprecipitation for protein interaction studies

  • Validation considerations:

    • Confirm specificity with appropriate controls

    • Validate cross-reactivity between human and pig AGTR1 when using commercial antibodies

    • Consider tissue-specific optimization for immunohistochemical applications

What are the critical quality control parameters for recombinant pig AGTR1 production?

Ensuring high-quality recombinant pig AGTR1 requires monitoring several parameters:

  • Purity assessment:

    • SDS-PAGE analysis with target purity >90%

    • Endotoxin levels <1.0EU per 1μg (typically determined by LAL method)

  • Structural integrity:

    • Correct molecular weight (predicted vs. observed)

    • Appropriate isoelectric point (expected around 8.3 based on human AGTR1)

    • Proper folding verification through functional assays

  • Functional validation:

    • Ligand binding capacity

    • Signal transduction capability

    • Pharmacological response to known agonists and antagonists

  • Stability testing:

    • Thermal stability assessment (e.g., 37°C incubation for 48h)

    • Storage stability at different temperatures

    • Freeze-thaw stability evaluation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.