Recombinant Pig Type I iodothyronine deiodinase (DIO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
DIO1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
DIO1
Target Protein Sequence
MELPLPGLWLKRLWVLFQVALHVAMGKVLMTLFPGRVKQDILAMSQKTGMAKNPHFSHEN WIPTFFSAQYFWFVLKVRWQRLEDKTEEGGLAPNCPVVSLSGQRCHIWDFMQGNRPLVLN FGSCTUPSFIFKFDQFKRLIEDFSSIADFLIIYIEEAHASDGWAFKNNVDIKNHQNLQDR LRAAHLLLDRSPQCPVVVDTMKNQSSRLYAALPERLYVLQAGRILYKGKPGPWNYHPEEV RAVLEKLHS
Uniprot No.

Target Background

Function
This recombinant pig Type I iodothyronine deiodinase (DIO1) is responsible for the deiodination of thyroxine (T4) to triiodothyronine (T3) and the subsequent deiodination of T3 to 3,3'-diiodothyronine (T2).
Gene References Into Functions
  1. Increased D1 activity in the liver and kidney of T4-treated pigs was observed. PMID: 15192045
Database Links
Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of pig Type I iodothyronine deiodinase (DIO1)?

Pig Type I iodothyronine deiodinase (DIO1) is a membrane-anchored homo-dimeric selenoprotein that shares the thioredoxin-fold structure with other deiodinase isoenzymes. It belongs to a family of three iodothyronine deiodinases (D1, D2, and D3) that regulate local and systemic availability of thyroid hormone . DIO1 primarily functions to activate the prohormone thyroxine (T4) to the thyromimetically active triiodothyronine (T3) .

The protein contains a critical selenocysteine residue (Sec) at position 126 in its catalytic site that is essential for enzymatic activity. Structurally, pig DIO1 forms homodimers and contains several conserved cysteine residues that play crucial roles in catalysis and protein function . These structural elements are integral to its ability to regulate thyroid hormone metabolism.

How do porcine deiodinases compare to human and rodent counterparts in catalytic properties?

Porcine deiodinases (D1, D2, and D3) exhibit catalytic properties that are virtually identical to those reported for human and rodent deiodinases . This high degree of functional conservation makes pig models valuable for thyroid hormone research with translational relevance to human physiology.

What are the key amino acid residues involved in the catalytic mechanism of DIO1?

Several conserved amino acid residues are critical for the catalytic activity of DIO1:

  • Selenocysteine (Sec126): The primary catalytic residue responsible for abstracting iodine from thyroid hormones.

  • Cysteine 124: Forms a selenenyl-sulfide with Sec126 during catalysis, which is the substrate for the physiological reductant glutathione .

  • Threonine 125: Essential for deiodination, as DIO1 T125A mutations result in complete loss of activity. The hydroxyl group of Thr125 is particularly important, as substitution with serine (T125S) maintains activity .

  • Histidine 174: Critical for activity, likely participating in proton transfer. Interestingly, H174A mutants retain activity while H174Q mutants lose all activity, suggesting a role in maintaining access to solvent for proton transfer .

  • Glutamate 156: Part of the proposed proton relay pathway .

These residues form a hydrogen-bonded network that facilitates proton transfer during catalysis, essential for the deiodination reaction.

What are the optimal expression systems for recombinant pig DIO1?

Based on current research, two expression systems have proven effective for recombinant pig DIO1:

Insect Cell Expression System:

  • High Five insect cells using baculoviral transduction have successfully expressed recombinant DIO1 with Sec replaced by Cys (DIO1 U126C) .

  • This system allows for higher protein yields compared to mammalian expression systems.

  • The protein can be tagged (e.g., with His-tag) to facilitate purification and detection.

  • Ideal for biochemical and structural studies requiring larger amounts of protein.

Mammalian Cell Expression (COS7 cells):

  • Allows expression of DIO1

  • More suitable for functional studies where authentic selenoprotein expression is desired.

  • Better post-translational modifications compared to insect cells.

  • Lower yields than insect cells but better representation of native enzyme properties .

When selecting an expression system, researchers should consider:

  • The purpose of the study (structural analysis vs. functional characterization)

  • Whether selenocysteine incorporation is essential

  • Required protein yield

  • Post-translational modifications needed

How can researchers accurately measure DIO1 enzymatic activity in experimental settings?

Recommended Methodological Approach:

  • Radioactive Deiodination Assay:

    • The gold standard for measuring deiodinase activity

    • Uses 125I-labeled substrates (rT3 or T4)

    • Measures the release of 125I (for 5'-deiodination activity)

    • Provides high sensitivity and specificity

  • Key Assay Components:

    • Substrate: Typically reverse T3 (rT3) for DIO1

    • Reducing system: Either dithiothreitol (DTT, 20 mM) or physiological reductants:

      • Glutathione system (GSH, glutaredoxin, glutathione reductase, and NADPH)

      • Thioredoxin system (thioredoxin, thioredoxin reductase, and NADPH)

    • Buffer conditions: Phosphate buffer (pH 7.0-7.4) with EDTA

    • Membrane fraction preparation from expressing cells

  • Controls and Validations:

    • Negative controls: DIO1 U126A mutants

    • Specific inhibitor: propylthiouracil (PTU) for DIO1

  • Data Analysis:

    • Activity expressed as pmol I- released per min per mg protein

    • Kinetic parameters (Km, Vmax) calculated using Lineweaver-Burk or Eadie-Hofstee plots

This approach allows for reliable quantification of DIO1 activity under various experimental conditions and with different protein variants .

What are the challenges in expressing recombinant selenoproteins like DIO1 and how can they be overcome?

Key Challenges:

  • Selenocysteine Incorporation:

    • Requires specific UGA codon recognition as Sec rather than stop

    • Needs SECIS (Selenocysteine Insertion Sequence) element in mRNA

    • Limited efficiency of selenoprotein synthesis machinery

  • Low Expression Yields:

    • Selenoproteins typically express at much lower levels than standard proteins

    • Limiting for structural and biochemical studies

  • Membrane Association:

    • DIO1 is a membrane protein, complicating solubilization and purification

    • Risk of losing activity during extraction

Solution Strategies:

  • Selenocysteine Substitution:

    • Replace Sec with Cys for higher yields

    • Example: DIO1 U126C retains some activity and allows higher expression

    • Useful for structural studies, though catalytic properties differ

  • Optimization of Expression Systems:

    • Insect cells for higher yields of Cys-substituted variants

    • Mammalian cells with optimized selenoprotein expression elements

    • Codon optimization for the host expression system

  • Purification Approaches:

    • Addition of solubilizing tags (His, FLAG)

    • Gentle detergent extraction (Triton X-100, CHAPS)

    • Use of enterokinase cleavage sites for tag removal

  • Activity Preservation:

    • Inclusion of reducing agents during purification

    • Working at lower temperatures

    • Avoiding freeze-thaw cycles

By addressing these challenges systematically, researchers can significantly improve the yield and quality of recombinant DIO1 for their studies.

What is the current understanding of the catalytic mechanism of DIO1?

The catalytic mechanism of DIO1 involves several key steps and structural elements:

  • Initial Substrate Interaction:

    • The iodothyronine substrate (T4 or rT3) binds to a pocket near the catalytic selenocysteine (Sec126)

    • Substrate orientation is critical for regioselective deiodination

  • Deiodination Reaction:

    • The selenolate (Se-) at Sec126 attacks the C-I bond of the substrate

    • This results in abstraction of an iodonium ion (I+)

    • Formation of a selenenyl-iodide intermediate (E-Se-I)

  • Regeneration Phase:

    • The selenenyl-iodide is reduced to selenol, releasing iodide

    • This involves formation of a selenenyl-sulfide between Sec126 and Cys124

    • The selenenyl-sulfide is subsequently reduced by glutathione or other reductants

  • Proton Relay System:

    • A hydrogen-bonded network transfers protons to the substrate after iodine abstraction

    • Key residues include Thr125, Glu156, and His174

    • His174 likely interfaces with solvent to facilitate proton transfer

This mechanism is supported by mutagenesis studies and mass spectrometry evidence showing formation of the Cys124-Sec126 selenenyl-sulfide intermediate during catalysis .

How is DIO1 activity regulated in different thyroid states in pigs?

DIO1 activity in pigs shows specific regulation patterns across thyroid states, providing insights into thyroid hormone homeostasis:

Hyperthyroid State:

  • T4 treatment increases DIO1 activity in liver and kidney of pigs

  • This represents a positive feedback mechanism that enhances T3 production during hyperthyroidism

  • Similar to regulation observed in humans but differs from some rodent models

Hypothyroid State:

  • Methimazole treatment (inducing hypothyroidism) reduces DIO1 activity

  • The expression is tightly regulated with regard to developmental stage and cell type

  • This provides fine-tuning of T3 supply to target cells

Tissue-Specific Regulation:

  • DIO1 expression in pigs shows tissue distribution patterns more similar to humans than rodents

  • This suggests that pigs represent a better model for studying human thyroid hormone metabolism

This thyroid state-dependent regulation of DIO1 in pigs makes them valuable models for studying disorders of thyroid hormone metabolism that affect DIO1 expression and activity .

What role do specific cysteines play in the structure and function of DIO1?

Conserved cysteines in DIO1 serve critical roles in both structural integrity and catalytic function:

  • Cys124 (Proximal Cysteine):

    • Forms a selenenyl-sulfide with Sec126 during catalysis

    • Essential for reduction by glutathione but not by dithiothreitol (DTT)

    • Mutation (C124A) prevents reduction by GSH while 20mM DTT still regenerates the enzyme

    • Direct evidence from mass spectrometry confirms Cys124-Cys126 disulfide formation

  • Cys194 (Distal Cysteine):

    • Less critical for catalytic activity

    • May play a structural role in the enzyme

  • Cys95 and Cys105:

    • Initially hypothesized to be involved in intermolecular disulfide formation

    • Mutation of either does not reduce activity with DTT or GSH-reducing systems

    • Mass spectrometry found no evidence for Cys95-Cys95, Cys95-Cys105, or Cys105-Cys105 intermolecular disulfides

The identification of the intramolecular Cys124-Sec126 selenenyl-sulfide represents a significant advancement in understanding DIO1 catalysis, as this is the first direct evidence for such an intermediate that had been theoretically predicted but not previously demonstrated .

Why are pig models considered superior to rodent models for studying deiodinase function?

Pig models offer several significant advantages over rodent models for studying deiodinase function, particularly for translational research relevant to human physiology:

  • Tissue Distribution Similarity:

    • D2 expression has been observed in human thyroid and skeletal muscle but not in these tissues in rodents

    • Pig deiodinase tissue distribution patterns more closely match human patterns

  • Physiological Similarity:

    • Pigs show high similarity to humans in body size, organ size and structure, physiology, and pathophysiology

    • Thyroid hormone metabolism pathways are more comparable to humans

  • Developmental Patterns:

    • Porcine deiodinase expression during development better mimics human patterns

    • This is particularly relevant for studying developmental roles of thyroid hormones

  • Experimental Advantages:

    • Larger size allows for repeated sampling from the same animal

    • Multiple tissue collection in quantities sufficient for diverse analyses

    • Surgical interventions more comparable to human procedures

  • Translational Relevance:

    • Drug metabolism and pharmacokinetics of thyroid-related medications more similar to humans

    • Pathophysiological changes in disease models better reflect human conditions

These advantages make pig models particularly valuable for studying thyroid hormone dysregulation in human diseases and for developing targeted therapeutic approaches .

What methods are used to create transgenic pig models for DIO1 research?

Creating transgenic pig models for DIO1 research involves several sophisticated genetic engineering approaches:

  • Somatic Cell Nuclear Transfer (SCNT):

    • Genetic modification of somatic cells (typically fibroblasts)

    • Transfer of modified nucleus to enucleated oocyte

    • Implantation into surrogate mother

    • Allows precise genetic modifications but has lower efficiency

  • CRISPR/Cas9 Genome Editing:

    • Direct injection of CRISPR/Cas9 components into zygotes

    • Can create knock-out, knock-in, or point mutations in DIO1 gene

    • Higher efficiency than traditional methods

    • Enables precise modification of specific amino acids (e.g., Cys124, Sec126)

  • Lentiviral Transgenesis:

    • Infection of early embryos with lentiviruses carrying the transgene

    • Useful for overexpression studies

    • Less precise than CRISPR but can achieve high expression levels

  • Transposon-Mediated Integration:

    • Sleeping Beauty or PiggyBac transposon systems

    • Allows integration of larger DNA fragments

    • Useful for expressing human DIO1 variants in pigs

Considerations for DIO1 Research:

  • Mini pigs are often preferred due to easier handling and faster reproductive cycles

  • Selection of appropriate promoters to achieve tissue-specific expression

  • Inclusion of reporter genes to track expression

  • Design of selenoprotein expression constructs that account for species-specific SECIS elements

These approaches enable the development of pig models with specific DIO1 modifications to study thyroid hormone metabolism, disease mechanisms, and potential therapeutic interventions .

How can recombinant pig DIO1 contribute to understanding thyroid disorders?

Recombinant pig DIO1 serves as a valuable tool for understanding thyroid disorders through multiple research applications:

  • Mechanistic Studies:

    • Structure-function analysis of DIO1 mutations identified in thyroid disorders

    • Investigation of how specific amino acid changes affect catalytic activity

    • Understanding the molecular basis of resistance to deiodinase inhibitors

  • Drug Development and Screening:

    • Screening of compounds that modulate DIO1 activity

    • Development of specific inhibitors or activators for therapeutic purposes

    • Testing structure-activity relationships of potential therapeutics

  • Biomarker Identification:

    • Development of assays to measure DIO1 activity in clinical samples

    • Correlation of DIO1 activity with disease progression

    • Identification of patient subgroups that might benefit from targeted therapies

  • Translational Research Applications:

    • Creation of pig models with DIO1 variants to study human thyroid disorders

    • Testing of therapeutic approaches in physiologically relevant systems

    • Evaluation of long-term consequences of altered DIO1 activity

The high similarity between porcine and human DIO1 makes recombinant pig DIO1 particularly valuable for translational research, offering insights that may be directly applicable to human thyroid disorders .

What mass spectrometry approaches are most effective for studying DIO1 structure and modifications?

Advanced mass spectrometry techniques have proven valuable for studying DIO1 structure and modifications, particularly for identifying critical intermediates in the catalytic mechanism:

Recommended MS Approaches:

  • LC-MS/MS with Thiol-Specific Labeling:

    • N-Ethylmaleimide (NEM) blocking of free thiols before sample processing

    • In-gel digestion with chymotrypsin/trypsin combination

    • Analysis by liquid chromatography-tandem mass spectrometry

    • Effective for identifying intramolecular disulfides like Cys124-Cys126

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Application of specific cross-linkers to capture protein-protein interactions

    • Useful for studying DIO1 dimerization and interactions with other proteins

    • Analysis of cross-linked peptides reveals spatial proximity of amino acids

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides insights into protein dynamics and conformational changes

    • Can reveal regions of DIO1 that undergo structural changes upon substrate binding

    • Useful for understanding the effects of mutations on protein structure

  • Targeted MS for Selenocysteine-Containing Peptides:

    • Special considerations for selenium-containing residues

    • Modified digestion protocols to preserve selenocysteine

    • Specific search parameters to identify selenopeptides

Key Experimental Considerations:

  • Sample preparation in the presence or absence of substrate to capture catalytic intermediates

  • Careful blocking of free thiols to prevent artificial disulfide formation

  • Comparison of oxidized vs. reduced states of the enzyme

  • Multiple proteases to achieve optimal sequence coverage

These mass spectrometry approaches have successfully demonstrated the formation of the Cys124-Cys126 intramolecular disulfide in recombinant DIO1, providing direct evidence for a critical catalytic intermediate that had been theoretically predicted but not previously observed .

What are the emerging technologies for studying the kinetics of DIO1-catalyzed reactions?

Several cutting-edge technologies are advancing our understanding of the kinetics of DIO1-catalyzed reactions:

  • Real-Time Fluorescence-Based Assays:

    • Development of fluorescent thyroid hormone analogs

    • Allows continuous monitoring of deiodination reactions

    • Provides real-time kinetic data without radioactive materials

    • Higher throughput than traditional radioactive assays

  • Single-Molecule Enzymology:

    • Tracking individual enzyme molecules during catalysis

    • Reveals heterogeneity in enzyme behavior

    • Identifies transitional states not visible in bulk measurements

    • Particularly useful for understanding the conformational changes during catalysis

  • Surface Plasmon Resonance (SPR):

    • Real-time measurement of protein-substrate interactions

    • Determination of association and dissociation rates

    • Analysis of how mutations affect substrate binding

    • No requirement for substrate modification or labeling

  • Computational Approaches:

    • Molecular dynamics simulations of the catalytic cycle

    • Quantum mechanical/molecular mechanical (QM/MM) calculations

    • Energy landscape mapping of reaction coordinates

    • In silico prediction of mutation effects on catalysis

  • Stopped-Flow Kinetics with Rapid Mixing:

    • Measurement of pre-steady-state kinetics

    • Identification of rate-limiting steps

    • Characterization of transient intermediates

    • Understanding the influence of reducing systems on reaction rates

These emerging technologies are expanding our toolbox beyond traditional radioactive assays, providing deeper insights into the catalytic mechanism of DIO1 and potentially identifying new targets for therapeutic intervention.

What are the future directions for pig DIO1 research in understanding selenoprotein biology?

Future directions for pig DIO1 research offer exciting opportunities to advance our understanding of selenoprotein biology:

  • Structural Biology:

    • Determination of the three-dimensional structure of pig DIO1

    • Comparison with human and other species' deiodinases

    • Structure-based drug design targeting specific deiodinases

    • Understanding the structural basis of dimerization and membrane association

  • Integration with Systems Biology:

    • Multi-omics approaches combining proteomics, transcriptomics, and metabolomics

    • Network analysis of DIO1 interactions in various physiological states

    • Tissue-specific regulation patterns in development and disease

    • Mathematical modeling of thyroid hormone metabolism

  • Translational Medicine Applications:

    • Development of pig models with specific DIO1 mutations found in human patients

    • Testing of personalized medicine approaches for thyroid disorders

    • Evaluation of novel therapies targeting deiodinase activity

    • Biomarker development for monitoring treatment efficacy

  • Comparative Selenoprotein Biology:

    • Understanding the evolution of the selenocysteine insertion machinery

    • Comparative analysis of selenoprotein function across species

    • Insights into why selenocysteine has been conserved despite the complexities of its incorporation

    • Development of improved selenoprotein expression systems

  • Advanced Genetic Models:

    • Conditional and inducible DIO1 modifications in pigs

    • Tissue-specific expression or deletion models

    • CRISPR/Cas9-mediated precise editing of catalytic residues

    • Models with humanized DIO1 for improved translational research

These future directions will not only advance our understanding of DIO1 function but also contribute to the broader field of selenoprotein biology, with potential implications for human health and disease treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.