Recombinant Pig Vesicle-associated membrane protein-associated protein B (VAPB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
VAPB; Vesicle-associated membrane protein-associated protein B; VAMP-B; VAMP-associated protein B; VAP-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-243
Protein Length
Full Length of Mature Protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPADTSDMEAAWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPVVSKALSSALDDTEVKKVMEECKRLQSEVQRLREENKQLKEEDGLRMRKPVLSNSPAPAPATPGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Uniprot No.

Target Background

Function
Vesicle-associated membrane protein-associated protein B (VAPB) participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in regulating cellular calcium homeostasis.
Database Links
Protein Families
VAMP-associated protein (VAP) (TC 9.B.17) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.

Q&A

Advanced Research Questions

  • How does VAPB contribute to ER-mitochondria contact sites in porcine cells and what methods can be used to study this?

VAPB plays a crucial role in establishing and maintaining ER-mitochondria contact sites (ERMCSs), which are essential for calcium signaling, lipid transfer, and mitochondrial function. In pig cells, as in other mammalian systems, VAPB likely functions as a tethering protein at these contact sites.

Methodological approaches to study pig VAPB at ERMCSs:

  • Proximity ligation assays (PLA): To detect VAPB interactions with mitochondrial proteins like PTPIP51

  • FRET-based biosensors: Modified FluoSTEP systems can be used to measure VAPB-localized cAMP generation, as demonstrated in studies where FRET cAMP sensors reconstitute in the presence of GFP fragments fused to VAPB

  • Mitochondrial PKA activity measurement: Using OMM-localized PKA biosensors to detect signaling events at ER-mitochondria interfaces mediated by VAPB

  • Co-immunoprecipitation with MS analysis: To identify VAPB-interacting proteins at contact sites

  • Super-resolution microscopy: To visualize VAPB localization at ERMCSs

Research has shown that GLP-1 receptor associates with VAPB at ERMCSs following its internalization, and this interaction mediates mitochondrial PKA signaling, which can be detected using specialized biosensors targeted to the outer mitochondrial membrane .

  • What is the role of pig VAPB in regulating lipid transport and homeostasis?

VAPB functions as a key regulator of lipid transport and homeostasis in mammalian cells, including porcine systems. As an ER-resident protein, VAPB helps establish membrane contact sites between the ER and other organelles, facilitating non-vesicular lipid transfer.

Experimental approaches to study VAPB's role in lipid transport:

  • Lipid transfer assays: Using fluorescently labeled lipids to track their movement between organelles in cells with normal or depleted VAPB levels

  • Lipidomic analysis: Mass spectrometry-based lipidomics to quantify changes in membrane lipid composition in VAPB-depleted pig cells

  • Protein-lipid binding assays: In vitro assays to determine the lipid-binding properties of recombinant pig VAPB

  • VAPB interactome analysis: Identifying lipid transport proteins that interact with VAPB at membrane contact sites

The MSP domain of VAPB has been implicated in binding lipid transfer proteins, and mutations in this domain can disrupt lipid homeostasis. Researchers studying pig VAPB should consider its potential role in regulating sterol and phospholipid transport between the ER and other organelles, which may be particularly important in metabolically active tissues .

  • How do post-translational modifications affect pig VAPB function and what techniques can detect these modifications?

Post-translational modifications (PTMs) of VAPB can significantly alter its function, localization, and interactions with binding partners. While specific PTMs of pig VAPB have not been extensively documented, based on homology with other mammalian VAPB proteins, several modifications likely occur:

  • Phosphorylation: May regulate VAPB's interaction with binding partners

  • Ubiquitination: Could control protein turnover

  • Proteolytic cleavage: The MSP domain can be cleaved and secreted as a signaling molecule

Methods to detect and characterize PTMs in pig VAPB:

  • Mass spectrometry:

    • Phosphoproteomic analysis using TiO₂ enrichment for phosphorylation sites

    • Proteolytic digestion followed by LC-MS/MS for comprehensive PTM mapping

  • Site-directed mutagenesis:

    • Creating recombinant pig VAPB variants with mutated PTM sites to assess functional impact

  • Western blotting:

    • Using phospho-specific antibodies to detect phosphorylated VAPB

    • Using antibodies against the N-terminal region to detect cleaved MSP domains

  • In vitro kinase assays:

    • To identify kinases that phosphorylate pig VAPB

When studying PTMs, researchers should consider comparing VAPB modifications under different cellular conditions, such as ER stress, which may reveal regulatory mechanisms.

  • What methodologies can detect the cleaved MSP domain of pig VAPB in biological samples?

The MSP domain of VAPB can be cleaved and secreted, functioning as an extracellular ligand with potential signaling properties . Detecting this cleaved domain in biological samples requires specific approaches:

  • Western blotting:

    • Using an anti-VAPB N-terminal antibody to detect the cleaved MSP domain (approximately 14-25 kDa)

    • Analyzing both cellular extracts and culture media/extracellular fluids

  • ELISA:

    • Developing sandwich ELISAs with antibodies targeting different epitopes of the MSP domain

    • Recombinant pig VAPB can serve as a standard for quantification

  • Immunoprecipitation followed by mass spectrometry:

    • To confirm the identity of cleaved MSP fragments in complex biological samples

  • Protein fractionation:

    • Using density gradient centrifugation to separate membrane-bound from soluble VAPB fragments

A practical protocol based on published approaches includes:

  • Collection of cerebrospinal fluid (CSF) or cell culture media

  • Concentration of proteins using TCA precipitation

  • SDS-PAGE separation

  • Western blotting with anti-VAPB (N-terminal) antibody

This approach has been used to assess VAPB cleavage products in PBL and CSF of ALS patients, and similar methods could be applied to porcine samples .

Experimental Design and Applications

  • How can researchers distinguish between VAPA and VAPB functions in porcine systems?

VAPA and VAPB share high sequence homology and can form both homo- and heterodimeric complexes , making it challenging to distinguish their specific functions. Robust experimental approaches include:

  • CRISPR/Cas9-mediated knockout models:

    • Generate single VAPA or VAPB knockouts

    • Generate double knockouts for comparison

    • Compare phenotypes between knockout models

  • RNA interference:

    • Use siRNA or shRNA with validated specificity for either VAPA or VAPB

    • Employ rescue experiments with RNAi-resistant constructs to confirm specificity

  • Protein-specific antibodies:

    • Use antibodies raised against unique peptide sequences not shared between VAPA and VAPB

    • Validate antibody specificity using knockout cells

  • Domain-swapping experiments:

    • Create chimeric proteins with swapped domains between VAPA and VAPB to identify domain-specific functions

  • Interactome analysis:

    • Compare binding partners of VAPA versus VAPB using co-immunoprecipitation followed by mass spectrometry

When designing experiments, consider that VAPA and VAPB may have both redundant and specific functions. For example, studies in other mammalian systems have shown that single knockout of either VAPA or VAPB often shows milder phenotypes than double knockouts, suggesting functional redundancy .

  • What models are most appropriate for studying pig VAPB in neurodegenerative disease research?

Pigs represent valuable large animal models for neurodegenerative diseases due to their similar brain anatomy and physiology to humans. For studying VAPB's role in neurodegenerative conditions like ALS, several approaches are suitable:

  • Primary cell models:

    • Porcine primary neurons or astrocytes expressing wild-type or mutant VAPB

    • Peripheral blood leukocytes (PBL) from pigs for analyzing VAPB expression patterns

  • Genome-edited pig models:

    • CRISPR/Cas9-generated pigs carrying VAPB mutations associated with ALS (e.g., P56S mutation)

    • Conditional knockout models to study tissue-specific effects

  • iPSC-derived models:

    • Porcine induced pluripotent stem cells differentiated into motor neurons

    • Co-culture systems with supporting cells (astrocytes, microglia)

  • Ex vivo tissue models:

    • Organotypic brain or spinal cord slice cultures from pigs

  • Biofluid analysis:

    • Cerebrospinal fluid sampling for analyzing VAPB cleavage products

When studying VAPB in neurodegeneration, researchers should assess:

  • Protein aggregation and misfolding

  • ER stress responses

  • Calcium homeostasis

  • Mitochondrial function

  • Motor neuron survival

The expression pattern of VAPB cleavage products in PBL and CSF can provide valuable biomarkers, as altered VAPB function has been implicated in sporadic ALS .

  • How does VAPB interact with the GLP-1 receptor in porcine cells, and what experimental approaches can elucidate this interaction?

Recent research has revealed that VAPB interacts with the GLP-1 receptor (GLP-1R) at ER-mitochondria contact sites following receptor internalization. This interaction appears to play a role in mitochondrial signaling and function.

Experimental approaches to study this interaction in porcine systems:

  • Co-immunoprecipitation assays:

    • Precipitate GLP-1R and probe for VAPB co-precipitation

    • The interaction is enhanced following stimulation with GLP-1R agonists

  • Proximity ligation assays (PLA):

    • To visualize GLP-1R-VAPB interactions in intact cells

  • Modified FRET biosensors:

    • FluoSTEP systems where FRET cAMP sensors reconstitute only in the presence of GFP fragments fused to VAPB

    • This approach allows measuring VAPB-localized cAMP generation

  • Functional studies:

    • Measuring mitochondrial PKA activity using OMM-localized PKA biosensors

    • Assessing mitochondrial function following GLP-1R activation in cells with normal or depleted VAPB

  • Internalization assays:

    • Blocking GLP-1R endocytosis using dynamin inhibitors (K44A mutants) to prevent VAPB interaction

The experimental evidence indicates that the interaction between GLP-1R and VAPB is dependent on receptor internalization, and different GLP-1R agonists trigger varying degrees of this interaction based on their ability to promote receptor internalization .

Research Applications

  • How can recombinant pig VAPB contribute to understanding calcium homeostasis mechanisms?

VAPB plays a crucial role in calcium homeostasis through its function at ER-mitochondria contact sites, making recombinant pig VAPB valuable for studying these mechanisms:

  • Reconstitution systems:

    • Liposome-based systems incorporating purified recombinant VAPB

    • Measure calcium transfer between artificial membranes

  • Live-cell calcium imaging:

    • Compare calcium dynamics in VAPB-knockout versus wild-type pig cells

    • Use targeted calcium sensors to measure calcium levels at specific subcellular compartments

  • ER stress response studies:

    • Examine how VAPB levels affect calcium-dependent ER stress responses

    • Monitor unfolded protein response activation in relation to VAPB function

  • Structure-function analyses:

    • Create recombinant VAPB variants with mutations in domains important for calcium regulation

    • Assess their impact on calcium homeostasis in cellular models

  • Interactome studies:

    • Identify calcium-related binding partners of pig VAPB

    • Use proximity labeling approaches (BioID, APEX) to find proteins near VAPB at contact sites

Calcium dysregulation has been implicated in neurodegenerative conditions linked to VAPB mutations, making these studies particularly relevant for understanding disease mechanisms . Researchers can use recombinant pig VAPB as both a tool for mechanistic studies and as a standard for measuring endogenous VAPB levels in porcine tissues.

  • What approaches can detect conformational changes in recombinant pig VAPB under different experimental conditions?

Understanding conformational dynamics of VAPB is crucial for elucidating its function in different cellular contexts. Several biophysical and biochemical approaches can detect these changes:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps regions of the protein that undergo conformational changes under different conditions

    • Can identify domains involved in protein-protein interactions

    • Protocol: Incubate recombinant VAPB in D₂O buffer under varying conditions, quench the reaction at different timepoints, digest with pepsin, and analyze by LC-MS/MS

  • FRET-based conformational sensors:

    • Engineer pig VAPB with fluorescent protein pairs at N- and C-termini

    • Measure FRET efficiency changes under different conditions (pH, calcium levels, binding partners)

  • Limited proteolysis:

    • Expose recombinant VAPB to proteases under different conditions

    • Compare digestion patterns by SDS-PAGE or mass spectrometry

    • Conformational changes alter protease accessibility

  • Differential scanning fluorimetry (DSF):

    • Measure thermal stability profiles of VAPB under various conditions

    • Binding partners or conformational changes can alter melting temperatures

  • Small-angle X-ray scattering (SAXS):

    • Provides low-resolution structural information in solution

    • Can detect large-scale conformational changes under different conditions

These approaches can reveal how pig VAPB structure changes during:

  • Binding to interaction partners

  • Membrane association/dissociation

  • ER stress conditions

  • Changes in calcium concentration

  • pH variations

Understanding these conformational dynamics is especially important for VAPB's role as a tethering protein at membrane contact sites, where structural flexibility may be crucial for function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.