Recombinant Pig Voltage-dependent calcium channel gamma-1 subunit (CACNG1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

CACNG1 encodes the gamma-1 subunit of voltage-dependent L-type calcium channels, integral to skeletal muscle excitation-contraction coupling . The recombinant pig variant is produced using expression systems such as E. coli, yeast, or mammalian cells, often fused with a His tag for purification .

Functional Role in Calcium Channel Regulation

CACNG1 regulates inactivation kinetics of L-type calcium channels in skeletal muscle, modulating calcium influx during depolarization . Its interaction with other channel subunits (α1, β, α2δ) ensures proper channel assembly and function .

Pathway Involvement:

  • Excitation-Contraction Coupling: Directly links membrane depolarization to calcium release in muscle .

  • Disease Associations: Mutations are linked to malignant hyperthermia and epilepsy .

A. Basic Research

  • Antibody Development: CACNG1-specific antibodies enable Western blot, IHC, and ELISA across species (human, mouse, rat) .

  • Channel Dynamics: Studies using recombinant CACNG1 clarify its role in channel inactivation and drug binding .

B. Therapeutic Targeting

A 2024 patent highlights CACNG1-binding proteins for skeletal muscle-specific drug delivery, leveraging its high expression in muscle tissue .

Challenges and Future Directions

  • Structural Complexity: Membrane-associated nature complicates crystallization for structural studies .

  • Therapeutic Potential: CACNG1-targeted conjugates for muscle disorders are in preclinical development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CACNG1; Voltage-dependent calcium channel gamma-1 subunit; Dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
Target Protein Sequence
MSQTKALKVRVTLFCILVGIVLALVAVVTDHWAVLSPHVEHLNATCEAAHFGLWRICTKR IAVGDSKDKSCGPITLPGEKNCSYFRHFNPGETSEIFHVTTQKEYSISAAAIAIFSLGFI ILGTICGLLSFRKKRDYLLRPASMFYAFAGLCIFVSVEVMRQSVKRMIDSEDTVWIDYYY GWSFACACAAFILLFLGGIALLLFSLPRMPQYPWESCMDAEPEH
Uniprot No.

Target Background

Function
The gamma-1 subunit (CACNG1) is a regulatory subunit of the voltage-gated calcium channel responsible for L-type calcium currents in skeletal muscle. It plays a crucial role in regulating channel inactivation kinetics.
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Cell membrane, sarcolemma; Multi-pass membrane protein.

Q&A

How does CACNG1 differ from other calcium channel gamma subunits?

CACNG1 is one member of an eight-member protein family of calcium channel gamma subunits, but has distinctive tissue expression and functional properties:

  • Tissue specificity: CACNG1 is predominantly expressed in skeletal muscle, while other gamma subunits (such as CACNG4) are more widely expressed across tissues .

  • Functional effects: CACNG1 specifically inhibits L-type CaV1.1 channels in skeletal muscle but can physically associate with cardiac L-type CaV1.2 channels with different effects .

  • Structural interactions: CACNG1 has been shown to interact with voltage-sensing domain IV (VSD IV) in alpha1 subunits of calcium channels .

Unlike CACNG4, which has been implicated in conditions such as diabetes and shows altered expression in human islets with elevated HbA1c levels, CACNG1's role appears more specific to skeletal muscle function .

What are the key domains and functional motifs in pig CACNG1?

The recombinant pig CACNG1 protein contains several key functional domains:

  • Four transmembrane segments: These anchor the protein in the membrane and are critical for its association with the main alpha1 subunit.

  • Extracellular loops: Particularly important for interactions with other channel components and potential modulating factors.

  • Cytoplasmic domains: The N and C terminal regions participate in intracellular signaling and interactions with other channel components .

  • Protein interaction sites: Specific residues in CACNG1 form ionic interactions with the IVS3-S4 loop of the CaV1.1 alpha1 subunit, which is crucial for its modulatory effects on calcium current .

The protein contains multiple glycosylation sites which may affect its stability, localization, and function in different cellular contexts.

What are the optimal conditions for expressing recombinant pig CACNG1 in E. coli?

For optimal expression of recombinant pig CACNG1 in E. coli, researchers should consider the following protocol:

  • Expression construct: Use a vector with an N-terminal His tag fused to the full-length CACNG1 (1-224 amino acids) for ease of purification .

  • E. coli strain: BL21(DE3) or similar strains optimized for membrane protein expression are recommended.

  • Culture conditions:

    • Grow cultures at 37°C until OD600 reaches 0.6-0.8

    • Induce with 0.5-1.0 mM IPTG

    • After induction, lower temperature to 18-20°C for 16-20 hours to enhance proper folding

  • Lysis buffer: Use a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors.

  • Purification: Employ nickel affinity chromatography followed by size exclusion chromatography to obtain protein with >90% purity .

The final product should be stored as a lyophilized powder to enhance stability, with reconstitution in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 immediately before use .

How should recombinant CACNG1 protein be stored and handled for optimal stability?

To maintain optimal stability and functionality of recombinant CACNG1 protein:

  • Storage conditions:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • For long-term storage, aliquot reconstituted protein with 5-50% glycerol (final concentration) and store at -20°C/-80°C

    • The default final concentration of glycerol recommended is 50%

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to prevent freeze-thaw damage

  • Handling precautions:

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • Working aliquots can be stored at 4°C for up to one week

    • Always use sterile techniques when handling the protein

After reconstitution, the protein should maintain >90% purity as determined by SDS-PAGE, with functional activity preserved when proper storage conditions are maintained .

What methods are effective for detecting CACNG1 in experimental systems?

Several validated methods can be employed for detecting CACNG1 in experimental systems:

  • Western Blotting:

    • Use polyclonal antibodies targeting specific regions (e.g., aa 66-115) of CACNG1

    • Recommended dilution: 1:500-1:2000

    • Sample preparation: Standard SDS-PAGE with reducing conditions

  • Immunohistochemistry (IHC):

    • Both standard and paraffin-embedded section protocols are effective

    • Antigen retrieval: Citrate buffer (pH 6.0) heat-induced method

    • Antibody dilution: 1:100-1:400

    • Detection: ABC or polymer-based detection systems with DAB chromogen

  • Immunofluorescence:

    • Fixation: 4% paraformaldehyde followed by permeabilization with 0.1% Triton X-100

    • Blocking: 5% normal serum from the secondary antibody host species

    • Primary antibody incubation: Overnight at 4°C

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation using anti-CACNG1 antibodies

    • Proximity ligation assays for in situ interaction studies

    • Pull-down assays using recombinant His-tagged CACNG1

When using antibodies, validation of specificity is crucial, particularly when examining tissues with potential cross-reactivity with other CACNG family members.

How does the γ1 subunit (CACNG1) modulate calcium current in CaV1.1 channels?

The modulation of calcium currents by CACNG1 in CaV1.1 channels involves complex mechanisms that depend on specific structural interactions:

These findings indicate that CACNG1's modulatory effects may operate through allosteric mechanisms, where inclusion of exon 29 in CaV1.1a enables CACNG1 to exert its inhibitory action on calcium currents through structural rearrangements in the channel complex .

What is the role of CACNG1 in excitation-contraction coupling in skeletal muscle?

CACNG1 plays a specific role in the fine-tuning of excitation-contraction (EC) coupling in skeletal muscle:

  • Voltage sensing modulation: CACNG1 influences the voltage-sensing function of CaV1.1, which is critical for EC coupling in skeletal muscle .

  • Developmental regulation: The interaction between CACNG1 and CaV1.1 splice variants contributes to the developmental regulation of calcium currents in skeletal muscle:

    • Adult muscles express CaV1.1a (containing exon 29), which has reduced calcium current density and shifted voltage dependence

    • This is partly mediated by CACNG1's inhibitory effect on CaV1.1a but not on the embryonic variant CaV1.1e

  • Functional consequences:

    • By reducing calcium influx through CaV1.1a in adult muscle, CACNG1 helps prevent calcium overload

    • The shift in inactivation to more negative voltages may protect against prolonged calcium entry during sustained depolarization

  • Structural basis: The interaction between CACNG1 and the voltage-sensing domain IV of CaV1.1 provides a mechanism for modulating calcium channel function specifically in the context of EC coupling machinery .

This specialized role distinguishes CACNG1 from other gamma subunits and highlights its importance in the mature skeletal muscle calcium handling system.

How do mutation or knockout of CACNG1 affect cellular calcium dynamics?

Research on CACNG1 mutations and knockout models reveals significant effects on calcium channel function and cellular calcium dynamics:

  • Altered channel gating: Absence of CACNG1 or function-altering mutations can lead to:

    • Increased calcium current density through CaV1.1a channels

    • Shifted voltage dependence of activation and inactivation

    • Changed kinetics of channel opening and closing

  • Calcium homeostasis disturbance: Altered CACNG1 function can disrupt cellular calcium homeostasis by:

    • Increasing calcium influx during depolarization

    • Altering the timing and magnitude of calcium release from sarcoplasmic reticulum

    • Affecting calcium-dependent feedback mechanisms

  • Physiological consequences: These alterations may manifest as:

    • Abnormal muscle contractility

    • Altered fatigue resistance

    • Potential susceptibility to calcium-dependent pathologies like malignant hyperthermia

  • Compensatory mechanisms: In CACNG1 knockout models, other calcium channel regulatory mechanisms may compensate, including:

    • Upregulation of calcium buffering proteins

    • Changes in expression of other channel subunits

    • Altered phosphorylation of CaV1.1 subunits

The specific effects of CACNG1 deficiency depend on the developmental stage, muscle type, and physiological context, highlighting the complex integration of CACNG1 in calcium channel macromolecular complexes.

How does pig CACNG1 compare structurally and functionally to human CACNG1?

Pig (Sus scrofa) and human CACNG1 share significant structural and functional similarities, with some notable differences:

Research has implicated various CACNG family members in several disease processes:

  • Neuropsychiatric Disorders:

    • CACNG4 and CACNG5 show significant association with schizophrenia risk

    • The SNP rs17645023 (located in the intergenic region between CACNG4 and CACNG5) is significantly associated with schizophrenia (OR = 0.856, P = 5.43 × 10−5)

    • A two-SNP haplotype (rs10420331-rs11084307) covering the intronic region of CACNG8 is significantly associated with schizophrenia (P = 1.4 × 10−6)

    • Significant statistical interaction exists between rs192808 (CACNG6) and rs2048137 (CACNG5) in schizophrenia risk (OR = 0.622, P = 2.93 × 10−6)

  • Metabolic Disorders:

    • CACNG4 (CaVγ4) is downregulated in:

      • Islets from human donors with diabetes

      • Diabetic Goto-Kakizaki (GK) rats

      • Islets from individuals with higher glycated hemoglobin (HbA1c) values

  • Cancer:

    • Various VGCC genes, including some CACNG family members, show altered expression in cancers

    • Different types of VGCCs appear to participate in diverse types of cancer

    • CACNA1A (alpha subunit that interacts with gamma subunits) is highly expressed in several cancers, including leukemia and ovarian cancer

These findings suggest that CACNG family members contribute to disease pathogenesis through multiple mechanisms, including direct effects on calcium channel function, altered receptor trafficking, and potential roles in cell signaling pathways critical for cell proliferation, differentiation, and survival .

What are common challenges in expressing and purifying functional recombinant CACNG1?

Researchers frequently encounter several challenges when expressing and purifying functional recombinant CACNG1:

  • Expression issues:

    • Low expression levels due to toxicity of membrane proteins to the host

    • Formation of inclusion bodies containing misfolded protein

    • Protein degradation during expression

    Solutions:

    • Use specialized E. coli strains (C41, C43, or Rosetta)

    • Lower induction temperature (16-18°C)

    • Use lower IPTG concentrations (0.1-0.5 mM)

    • Add membrane-stabilizing agents to the growth medium

  • Purification challenges:

    • Poor solubilization of membrane-bound protein

    • Co-purification of contaminants

    • Loss of native conformation during purification

    Solutions:

    • Optimize detergent type and concentration (try CHAPS, DDM, or Triton X-100)

    • Use two-step purification (affinity chromatography followed by size exclusion)

    • Include stabilizing agents (glycerol, specific lipids) in purification buffers

  • Functional assessment difficulties:

    • Verifying proper folding of purified protein

    • Confirming activity in isolation from native interaction partners

    • Reproducing membrane environment for functional studies

    Solutions:

    • Use circular dichroism to assess secondary structure

    • Reconstitute in liposomes or nanodiscs for functional studies

    • Co-express with interacting partners when possible

Careful optimization of expression conditions, solubilization methods, and purification protocols is essential for obtaining functional recombinant CACNG1 for research applications.

How can researchers effectively study CACNG1 interactions with calcium channel alpha subunits?

To effectively study interactions between CACNG1 and calcium channel alpha subunits, researchers can employ several complementary approaches:

  • Heterologous co-expression systems:

    • Establish stable cell lines expressing alpha subunits (α1S), auxiliary subunits (α2δ-1, β3, STAC3), and CACNG1

    • HEK293 cells have been successfully used for this purpose

    • Compare calcium current properties with and without CACNG1 expression

  • Protein-protein interaction assays:

    • Co-immunoprecipitation using antibodies against CACNG1 or alpha subunits

    • Pull-down assays with recombinant tagged proteins

    • FRET/BRET approaches to measure interactions in living cells

    • Surface plasmon resonance for quantitative binding measurements

  • Structural approaches:

    • Cryo-electron microscopy of channel complexes

    • Site-directed mutagenesis to identify critical interaction residues

    • Molecular modeling to predict interaction interfaces

  • Functional characterization:

    • Patch-clamp electrophysiology to measure changes in calcium current properties

    • Calcium imaging to assess effects on cellular calcium handling

    • Comparison of different splice variants (e.g., CaV1.1a vs. CaV1.1e) to identify specific modulatory mechanisms

A particularly effective approach demonstrated in research is the combination of stable cell line expression, electrophysiological characterization, and molecular modeling to identify structure-function relationships governing CACNG1 modulatory effects on calcium channels .

What controls and validation steps are essential when studying CACNG1 in experimental systems?

To ensure robust and reproducible results when studying CACNG1, the following controls and validation steps are essential:

  • Expression verification:

    • Western blotting with validated antibodies to confirm CACNG1 expression

    • qPCR to verify mRNA expression levels

    • Immunofluorescence to confirm subcellular localization

  • Functional controls:

    • Include both positive controls (known CACNG1-responsive systems) and negative controls (systems lacking CACNG1)

    • Compare wild-type CACNG1 with non-functional mutants

    • Use siRNA/shRNA knockdown to validate specificity of CACNG1 effects

  • Antibody validation:

    • Confirm antibody specificity using CACNG1 knockout/knockdown samples

    • Test for cross-reactivity with other CACNG family members

    • Validate across multiple applications (Western blot, IHC, IF)

  • System-specific controls:

    • For recombinant protein: Purity assessment by SDS-PAGE (>90% purity)

    • For cell systems: Control for expression levels of other calcium channel subunits

    • For functional studies: Pharmacological controls (channel blockers/modulators)

  • Reproducibility measures:

    • Biological replicates (n≥3) from independent experiments

    • Technical replicates to assess methodological variation

    • Consistent experimental conditions (temperature, pH, ionic composition)

These validation steps are particularly important given the potential for functional redundancy among CACNG family members and the complex interactions between calcium channel subunits that may influence experimental outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.