Recombinant Pig Zinc transporter SLC39A7 (SLC39A7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SLC39A7; HKE4; Zinc transporter SLC39A7; Histidine-rich membrane protein Ke4; Solute carrier family 39 member 7; Zrt-, Irt-like protein 7; ZIP7; Fragments
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Sus scrofa (Pig)
Target Names
SLC39A7
Target Protein Sequence
HSHHPLEQPRHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHG TRMEVMAWKTGVSSKEKQSSEEEEKEAGASRKRRGGSTRPKDGPVRPQHSGEEKQGQTCV CQGIILTTMTVLLHEVPHEVGDFAILVQSGCSKKQ
Uniprot No.

Target Background

Function

SLC39A7 is a zinc transporter that facilitates the movement of Zn2+ from the endoplasmic reticulum/Golgi apparatus to the cytosol. Transport is upregulated by growth factors (e.g., EGF), Ca2+, and exogenous Zn2+.

Database Links

UniGene: Ssc.19512

Protein Families
ZIP transporter (TC 2.A.5) family, KE4/Catsup subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is SLC39A7 (ZIP7) and what is its primary function in porcine cells?

SLC39A7, also known as ZIP7, is a membrane transport protein belonging to the ZIP family of zinc transporters. In pigs, as in other mammals, ZIP7 is primarily localized to the endoplasmic reticulum (ER) and Golgi apparatus membranes . Its principal function is to transport zinc from these organelles into the cytoplasm, thereby playing a crucial role in cellular zinc homeostasis .

The porcine SLC39A7 gene has been characterized with two distinct transcripts: variant 1 (2398 bp) and variant 2 (2088 bp) . Notably, variant 1 is ubiquitously expressed across porcine tissues, while variant 2 shows tissue-specific expression patterns, being absent in fat tissue .

How does the structure of porcine SLC39A7 compare to human and murine homologs?

Porcine SLC39A7 shares significant sequence homology with human and mouse counterparts, indicating evolutionary conservation of this protein . The protein features multiple transmembrane domains typical of zinc transporters. While human ZIP7 contains a histidine-rich region between transmembrane domains that likely functions as a zinc-binding domain, porcine ZIP7 shows similar structural characteristics .

Research indicates that porcine SLC39A7 contains 9 predicted transmembrane domains, consistent with the structure of ZIP transporters in other species . This structural conservation suggests functional similarities across species, making porcine models valuable for comparative studies.

What are the primary tissues expressing SLC39A7 in pigs, and how does expression vary between tissues?

The differential expression patterns suggest tissue-specific regulatory mechanisms and potentially specialized functions of SLC39A7 variants in different porcine tissues. This variation should be considered when designing tissue-specific studies using recombinant pig SLC39A7.

What are the optimal methods for cloning and expressing recombinant porcine SLC39A7?

For successful cloning and expression of recombinant porcine SLC39A7, researchers should consider the following methodological approach:

  • Gene isolation: The complete ORF of porcine SLC39A7 can be isolated using RT-PCR from tissue samples with high expression (e.g., liver or intestine) . Primer design should account for the two variants.

  • Vector selection: For mammalian expression, vectors containing strong promoters like CMV are recommended. For bacterial expression, pET systems with His-tags facilitate purification .

  • Expression system selection:

    • For functional studies: Mammalian cell lines (HEK293T, CHO)

    • For structural studies: Bacterial systems (E. coli)

    • For physiological studies: Porcine cell lines when available

  • Verification methods: Western blotting using anti-ZIP7 antibodies (cross-reactivity with porcine ZIP7 should be verified) and RT-PCR for transcript verification .

The inclusion of epitope tags (V5, FLAG, or His) at the C-terminus rather than the N-terminus is recommended to minimize interference with zinc transport function .

What are the established methods for measuring ZIP7 transporter activity in recombinant systems?

Measuring ZIP7 transport activity requires specialized techniques due to its intracellular localization. Established methodologies include:

  • Zinc fluorescence imaging: Using zinc-specific fluorophores like FluoZin-3 to visualize zinc flux from intracellular stores to cytoplasm following ZIP7 activation .

  • Radioisotope assays: Utilizing ⁶⁵Zn to track zinc movement across cellular compartments. For recombinant systems, cells expressing porcine ZIP7 will show altered ⁶⁵Zn distribution compared to controls .

  • Inductively coupled plasma mass spectrometry (ICP-MS): For precise quantification of zinc content in different cellular fractions .

  • Synchrotron radiation X-ray fluorescence (SR-XRF): For high-resolution spatial analysis of zinc distribution, particularly valuable for tissue-level studies .

For kinetic analyses, recombinant ZIP7 in LLC-PK₁ cells has shown concentration-dependent and saturable zinc transport that follows Michaelis-Menten kinetics with a K<sub>m</sub> of approximately 19.2 μM .

What controls and validation steps are essential when working with recombinant porcine SLC39A7?

When working with recombinant porcine SLC39A7, the following controls and validation steps are critical:

  • Expression validation:

    • Western blotting to confirm protein expression

    • Immunofluorescence to verify correct subcellular localization (ER/Golgi)

    • RT-PCR to confirm transcript expression

  • Functional validation:

    • Zinc transport assays comparing wild-type vs. mutant constructs

    • Complementation assays in ZIP7-deficient cells

    • Pharmacological inhibition using zinc chelators to confirm specificity

  • Essential controls:

    • Empty vector controls

    • Inactive mutant controls (e.g., mutations in predicted zinc-binding domains)

    • Wild-type human or mouse ZIP7 for cross-species comparison

  • Physiological relevance:

    • Validation in porcine cell lines when possible

    • Confirmation of expected downstream effects on zinc-dependent pathways

What significant polymorphisms exist in porcine SLC39A7 and how do they impact function?

Several polymorphisms have been identified in porcine SLC39A7 with potential functional consequences:

  • c.205G>A substitution in exon 3: This polymorphism changes glycine to arginine at position 69 (p.Gly69Arg) and has been significantly associated with carcass traits in pigs .

  • c.1138-216T>C substitution in intron 6: This intronic variation has been detected by PCR-CofI-RFLP and may influence splicing efficiency .

Allele frequency studies have revealed significant differences in the c.205G>A polymorphism distribution among six Chinese indigenous pig breeds and two commercial pig breeds, suggesting potential selection pressures related to this locus .

PolymorphismNucleotide ChangeAmino Acid ChangeAssociated TraitsDetection Method
Exon 3 SNPc.205G>Ap.Gly69ArgBackfat thickness, Leaf fat weightPCR-HpaII-RFLP
Intron 6 SNPc.1138-216T>CNone (intronic)Average backfat thicknessPCR-CofI-RFLP

How do mutations in SLC39A7 impact zinc homeostasis and cellular function in experimental models?

Mutations in SLC39A7 have profound effects on zinc homeostasis and cellular function as demonstrated in multiple experimental models:

  • Hypomorphic mutations: Studies have shown that hypomorphic mutations in SLC39A7 lead to reduced cytoplasmic zinc concentrations, resulting in increased phosphatase activity and decreased phosphorylation of signaling molecules in B cells .

  • Complete knockout effects: Complete loss of ZIP7 function is embryonic lethal in mouse models, underscoring its essential role in development . In contrast, hypomorphic alleles result in partial loss of function, allowing for the study of specific pathways affected by reduced ZIP7 activity.

  • Tissue-specific effects: In intestinal models, ZIP7 deficiency leads to:

    • Increased ER stress in proliferative progenitor cells

    • Loss of intestinal stem cells

    • Degeneration of Paneth cells

    • Impaired epithelial self-renewal

  • Molecular consequences:

    • Disruption of zinc-dependent signaling pathways

    • Altered phosphorylation cascades

    • Increased endoplasmic reticulum stress

    • Activation of apoptotic pathways

What is the relationship between SLC39A7 polymorphisms and economically important traits in pigs?

Research has established significant associations between SLC39A7 polymorphisms and economically important carcass traits in pigs:

  • Backfat measurements: The c.205G>A polymorphism has been significantly associated (p < 0.05) with backfat thickness at thorax-waist and average backfat thickness .

  • Fat deposition: A highly significant association (p < 0.01) has been found between SLC39A7 polymorphisms and leaf fat weight in pigs .

  • Genetic linkage: The c.205G>A polymorphism within the SLC39A7 gene has been shown to be closely linked to the marker Sw1856 on pig chromosome 7 in a Large White × Meishan F2 resource population .

These associations have been validated using both QTL studies and marker-assisted association analyses, confirming the role of SLC39A7 variants in influencing fat deposition traits in pigs .

How can CRISPR-Cas9 be utilized to study SLC39A7 function in porcine models?

CRISPR-Cas9 technology offers powerful approaches for studying SLC39A7 function in porcine models:

  • Generation of knockout models:

    • Complete knockout is likely embryonic lethal based on mouse studies

    • Conditional knockouts using tissue-specific promoters controlling Cre expression

    • Inducible systems (e.g., Tet-On/Off) to control the timing of ZIP7 deletion

  • Creation of hypomorphic alleles:

    • Precise modeling of hypomorphic mutations similar to those found in human diseases

    • Introduction of specific point mutations (e.g., p.Gly69Arg) to study polymorphism effects

  • Reporter systems:

    • Knock-in of fluorescent tags for real-time visualization of ZIP7 localization

    • Integration of zinc-responsive elements to monitor ZIP7 activity in live cells

  • Methodological considerations:

    • Design of guide RNAs with minimal off-target effects

    • Verification of edits by sequencing and functional assays

    • Careful phenotypic characterization of resulting models

When designing CRISPR experiments for porcine ZIP7, researchers should consider targeting conserved regions across species to maximize the translational relevance of findings.

What are the challenges and solutions in producing functional recombinant porcine ZIP7 protein for structural studies?

Producing functional recombinant porcine ZIP7 for structural studies presents several challenges:

Challenges:

  • Membrane protein expression: As a multi-pass transmembrane protein, ZIP7 is difficult to express in soluble form.

  • Proper folding: Maintaining native conformation during expression and purification is problematic.

  • Post-translational modifications: Critical modifications may be absent in bacterial systems.

  • Functional validation: Confirming that recombinant protein retains zinc transport activity.

Solutions:

  • Expression strategies:

    • Use specialized expression systems like insect cells (Sf9/Baculovirus)

    • Employ mammalian expression systems for proper post-translational modifications

    • Consider cell-free expression systems supplemented with lipids or nanodiscs

  • Purification approaches:

    • Detergent screening to identify optimal solubilization conditions

    • Lipid nanodisc reconstitution for maintaining native environment

    • GFP-fusion strategies for monitoring expression and folding

  • Structural analysis methods:

    • Cryo-electron microscopy for membrane proteins in native-like environments

    • X-ray crystallography of stabilized constructs

    • NMR studies of specific domains

Researchers have successfully used V5-tagged ZIP7 fusion proteins in functional studies , suggesting that C-terminal tagging approaches may be viable for both expression and purification while maintaining function.

How does phosphorylation regulate porcine ZIP7 activity and what are the implications for zinc signaling?

Phosphorylation plays a critical role in regulating ZIP7 activity and subsequent zinc signaling:

  • Phosphorylation mechanism:

    • Casein kinase 2 (CK2) phosphorylates ZIP7 at specific serine residues (Ser275 and Ser276 in human ZIP7)

    • Phosphorylation triggers zinc release from intracellular stores into the cytoplasm

    • This process acts as a "zinc wave" initiating downstream signaling cascades

  • Signaling pathways affected:

    • Activation of multiple kinase pathways including ERK1/2 and AKT

    • Inhibition of protein tyrosine phosphatases by released zinc

    • Modulation of cell proliferation and migration pathways

  • Experimental evidence:

    • Mutant ZIP7 with alanine substitutions at phosphorylation sites (S275A, S276A) fails to induce zinc release

    • Phosphorylation-deficient mutants show decreased activation of downstream kinases

    • CK2 inhibitors prevent ZIP7-mediated zinc release

  • Porcine-specific considerations:

    • While not extensively characterized in pigs, the phosphorylation sites are likely conserved based on sequence homology

    • Porcine ZIP7 likely responds to similar regulatory mechanisms given the functional conservation across species

These findings suggest that targeting the phosphorylation status of ZIP7 could provide mechanisms to modulate zinc signaling in research or therapeutic contexts.

What role does SLC39A7 play in immune function and how can this be studied using recombinant porcine models?

SLC39A7 plays crucial roles in immune function that can be investigated using recombinant porcine models:

  • B cell development:

    • ZIP7 is essential for B cell development and function

    • Hypomorphic mutations cause agammaglobulinemia and absent B cells

    • ZIP7 modulates B cell receptor signal strength and positive selection

  • Zinc signaling in immune cells:

    • ZIP7 controls cytosolic zinc levels that modulate phosphatase activity

    • This affects signaling molecules downstream of pre-B cell and B cell receptors

    • Zinc supplementation can partially rescue immunodeficiency in ZIP7-deficient models

  • Experimental approaches with porcine models:

    • Generation of recombinant porcine ZIP7 variants modeling human mutations

    • Analysis of B cell development in porcine bone marrow cultures

    • Ex vivo studies of primary porcine immune cells with modified ZIP7 expression

    • Creation of porcine ZIP7 reporter cell lines to monitor activity during immune responses

  • Methodological considerations:

    • Flow cytometry to assess B cell development stages

    • Analysis of immunoglobulin production

    • Phospho-flow to monitor signaling pathway activation

    • Zinc flux measurements in immune cells using fluorescent probes

The pig represents an excellent model for human immunology due to similarities in immune system development and function.

How is SLC39A7 implicated in cancer progression and what experimental approaches are used to investigate this?

SLC39A7 has been implicated in cancer progression through various mechanisms:

  • Altered expression:

    • SLC39A7 is commonly upregulated in cervical cancer tissues compared to normal controls

    • Expression analysis using techniques like Oncomine database mining shows consistent upregulation in multiple cancer types

  • Functional effects in cancer cells:

    • Knockdown of SLC39A7 significantly reduces cancer cell proliferation

    • SLC39A7 silencing increases apoptosis in cancer cell lines

    • SLC39A7 deficiency attenuates migratory and invasive abilities of cancer cells

  • Molecular mechanisms:

    • SLC39A7 knockdown upregulates pro-apoptotic factors (Bax) and downregulates anti-apoptotic factors (Bcl-2)

    • SLC39A7 affects epithelial-to-mesenchymal transition (EMT) by regulating E-cadherin and MMP-2 expression

    • CK2-mediated phosphorylation of ZIP7 activates zinc-dependent signaling pathways that promote cancer progression

  • Experimental approaches using recombinant systems:

    • shRNA or CRISPR-mediated knockdown/knockout studies

    • Overexpression of wild-type or mutant ZIP7 forms

    • Cell-based assays for proliferation, apoptosis, migration, and invasion

    • in vivo xenograft models with modified ZIP7 expression

What are the emerging therapeutic approaches targeting ZIP7 and how can recombinant porcine models contribute to their development?

Emerging therapeutic approaches targeting ZIP7 represent a promising area of research:

  • Potential therapeutic strategies:

    • Inhibitors of ZIP7 phosphorylation (CK2 inhibitors)

    • Small molecule modulators of ZIP7 zinc transport activity

    • Gene therapy approaches to correct ZIP7 mutations

    • Zinc supplementation to bypass ZIP7 deficiency in certain contexts

  • Disease applications:

    • Primary immunodeficiencies related to ZIP7 dysfunction

    • Cancer types with ZIP7 overexpression

    • Intestinal disorders affecting epithelial homeostasis

    • Conditions associated with ER stress

  • Contributions of recombinant porcine models:

    • Testing of pharmacological agents in physiologically relevant systems

    • Assessment of tissue-specific effects of ZIP7 modulation

    • Evaluation of gene therapy approaches using porcine cells

    • Preclinical studies of zinc supplementation strategies

  • Translational considerations:

    • Porcine physiology closely resembles human physiology

    • Similar pharmacokinetics and pharmacodynamics to humans

    • Valuable bridge between rodent studies and human clinical trials

    • Ability to model tissue-specific effects at scale relevant to humans

The conservation of ZIP7 structure and function between pigs and humans makes porcine models particularly valuable for therapeutic development targeting this zinc transporter.

What are the key unresolved questions regarding porcine SLC39A7 function and regulation?

Despite significant advances, several key questions about porcine SLC39A7 remain unresolved:

  • Isoform-specific functions:

    • What are the functional differences between the two transcript variants (2398 bp and 2088 bp) identified in pigs?

    • Why is variant 2 absent specifically in fat tissue, and what implications does this have?

  • Regulatory mechanisms:

    • What transcription factors and regulatory elements control tissue-specific expression of porcine ZIP7?

    • How is ZIP7 expression modulated in response to zinc availability and cellular stress?

    • What post-translational modifications beyond phosphorylation affect ZIP7 function?

  • Physiological roles:

    • What is the precise role of ZIP7 in adipose tissue development and metabolism in pigs?

    • How does ZIP7 contribute to muscle growth and development in production animals?

    • What is the relationship between ZIP7 function and economically important traits?

  • Comparative biology:

    • How do the functions of porcine ZIP7 compare with human and mouse orthologs?

    • Are there species-specific mechanisms of regulation or cellular responses?

    • Can porcine models accurately predict human responses to ZIP7-targeted interventions?

What novel technologies and approaches are emerging for studying zinc transporters in porcine models?

Several cutting-edge technologies are emerging for the study of zinc transporters in porcine models:

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing ZIP7 localization and dynamics

    • Synchrotron radiation X-ray fluorescence (SR-XRF) for high-resolution spatial mapping of zinc distribution

    • FRET-based zinc sensors for real-time monitoring of zinc flux in live cells

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-specific expression patterns of ZIP7

    • Single-cell proteomics to characterize ZIP7 protein levels and modifications

    • Spatial transcriptomics to map ZIP7 expression in tissue contexts

  • Structural biology advances:

    • Cryo-electron microscopy for determining ZIP7 structure in near-native conditions

    • Hydrogen-deuterium exchange mass spectrometry for studying conformational changes

    • Computational modeling of zinc transport mechanisms

  • Genetic engineering:

    • Base editing and prime editing for precise modification of ZIP7 sequences

    • Inducible and reversible gene regulation systems

    • Tissue-specific and temporal control of ZIP7 expression using synthetic biology approaches

  • Integrative approaches:

    • Multi-omics integration combining genomics, transcriptomics, proteomics, and metabolomics

    • Systems biology modeling of zinc homeostasis networks

    • AI/machine learning for predicting ZIP7 interactions and functions

How can comparative studies between human and porcine SLC39A7 advance our understanding of zinc transporter biology?

Comparative studies between human and porcine SLC39A7 offer significant opportunities for advancing zinc transporter biology:

  • Evolutionary insights:

    • Identification of conserved domains essential for ZIP7 function

    • Understanding species-specific adaptations in zinc homeostasis

    • Elucidation of evolutionary pressures shaping zinc transporter biology

  • Translational applications:

    • Validation of porcine models for human ZIP7-related disorders

    • Development of therapies with cross-species efficacy

    • Prediction of human responses based on porcine studies

  • Structural-functional relationships:

    • Comparison of species-specific post-translational modifications

    • Identification of critical residues for zinc coordination and transport

    • Understanding regulatory elements governing expression patterns

  • Methodological approaches:

    • Cross-species protein complementation assays

    • Chimeric proteins containing domains from both species

    • Parallel phenotypic studies in human and porcine cells

    • Comparative response to zinc supplementation or depletion

  • Disease modeling:

    • Generation of equivalent mutations in human and porcine ZIP7

    • Comparison of phenotypic consequences across species

    • Evaluation of species differences in therapeutic responses

These comparative approaches can reveal fundamental principles of zinc transporter biology while simultaneously validating porcine models for human health applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.