Recombinant Pinctada fucata Prisilkin-39

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Should you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Prisilkin-39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-406
Protein Length
Full Length of Mature Protein
Species
Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)
Target Protein Sequence
QSRRRAALTGLVAGATIGALASGGLGAGAGGFGVGGFPVGVGAVGIPVAVGGGIPYGYGG YSGYGYGYPAGGYGGYSYGYPTGGYGGYSYGYPTGGYGGYSYGYPTGGYGGYSYGYPTGG YSGYSYGYPTGGYSGYSYGYPTGGYSGYSYGYPTGGYSGYSYGYPTGGYSGYSYGYPTGG YSGYSYPTGGYSGYSYSSTPGYGYYGSGSGMGGMRSGYSYYSSPAPSYYSSGSMTPGYGY YSSGSGIGGGMGSGYSYYSSPAPSYYSSSVSPGYGYYGSGSGMRGYGYYSSSTPMYYGSR STGYGPFSSGLGGMGSGYSYYSSSTPSYYSSGSMTPGYGYYGSTSYPGPGYGSYSYRTTS YQPSSYGYSSYGTTYPGHGHWHGHKDC
Uniprot No.

Target Background

Function
Recombinant *Pinctada fucata* Prisilkin-39 binds chitin, potentially serving as a structural component in shell formation. It inhibits aragonite precipitation and may regulate aragonite growth during shell layer development. It does not affect calcite crystallization.
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expression is confined to the prism and organic layers of the shell with no expression detected in the nacreous shell layer. Also expressed in the mantle edge, extrapallial fluid, hemolymph and, to a lesser extent, in the viscus (at protein level). In the

Q&A

What is Prisilkin-39 and what is its role in biomineralization?

Prisilkin-39 is a novel matrix protein isolated from the mantle of the bivalve oyster Pinctada fucata (Akoya pearl oyster). It has a molecular mass of 39.3 kDa and an isoelectric point of 8.83 . This protein serves a unique dual function in shell biomineralization:

  • It participates in the construction of the organic framework by binding tightly to chitin, an insoluble polysaccharide that forms the structured framework of the shell .

  • It regulates crystal growth during prismatic layer formation, specifically by inhibiting aragonite precipitation .

Prisilkin-39 is considered significant because it was the first protein shown to have this dual functionality in shell formation, which has expanded our understanding of basic matrices and their functions in molluscan shell elaboration .

How is Prisilkin-39 expressed in Pinctada fucata tissues?

Prisilkin-39 expression is highly localized in specific tissues of Pinctada fucata:

Spatial Expression Pattern:

  • Localized to the inner epithelial cells of the outer fold and the outer epithelial cells of the middle fold at the bottom of the periostracal groove of the mantle

  • No hybridization signal detected in the dorsal mantle or inner fold

  • The expression pattern is partially similar to other prismatic layer proteins like Prismalin-14 and KRMP

Tissue-Specific Expression:

  • Primarily expressed in the mantle edge, corresponding to the calcitic prismatic layer formation

  • Significantly higher expression in the mantle edge compared to the pallium (inner mantle region)

  • Expression detected through in situ hybridization using digoxigenin-labeled probes generated from a 361-bp fragment

This expression pattern suggests Prisilkin-39's involvement in prismatic layer formation rather than nacreous layer formation, classifying it among the proteins specific to the prismatic shell layer of P. fucata .

What methods are used for recombinant expression and purification of Prisilkin-39?

Several expression systems have been employed for recombinant production of Prisilkin-39:

Expression Systems:

  • Yeast Expression System (P. pastoris)

    • Construction of expression vector pPIC9/Pf-Prisilkin-39

    • Expression in Pichia pastoris GS115 cells

    • Incorporation of a His tag at the N-terminus for purification

  • E. coli Expression System

    • Expression of full-length mature protein (residues 20-406)

    • N-terminal His-tag fusion for purification

    • Commonly used for commercial production of the recombinant protein

Purification Methods:

  • Affinity chromatography using nitrilotriacetic acid beads for His-tagged proteins

  • Optimization of purification through SDS-PAGE verification (>90% purity)

Storage and Handling:

  • Typically provided as lyophilized powder

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) for long-term storage

  • Storage at -20°C/-80°C with aliquoting to avoid repeated freeze-thaw cycles

The choice between expression systems depends on research needs, with yeast systems offering advantages in protein folding and post-translational modifications, while E. coli systems typically provide higher yields for structural studies .

How does Prisilkin-39 interact with chitin in shell formation?

Prisilkin-39 demonstrates specific and strong interactions with chitin, which is critical for its role in shell framework construction:

Binding Properties:

  • Binds tightly to chitin, an insoluble polysaccharide that forms the highly structured framework of the shell

  • The interaction is strong enough that Prisilkin-39 can only be detected in the EDTA-insoluble matrix (EISM) fractions of the shell, not in the EDTA-soluble matrix (ESM)

  • Requires denaturing conditions at high temperatures to release Prisilkin-39 from chitin complexes

Functional Significance:

  • Acts as a framework constituent participating in the shell formation process

  • Provides structural integrity to the organic matrix surrounding the calcitic prisms

  • The binding capacity enables Prisilkin-39 to serve as an interface between the organic framework and mineral components

Localization Evidence:

  • Immunostaining revealed the presence of Prisilkin-39 in the organic sheet (approximately 40 μm thick) sandwiched between the nacre and prismatic layers

  • Also detected in sheaths around the prisms, further confirming its structural role

This chitin-binding property makes Prisilkin-39 unique among shell matrix proteins and explains its critical role in the mechanical properties and organization of the prismatic layer .

What is the effect of Prisilkin-39 on calcium carbonate crystal formation in vitro?

Prisilkin-39 exhibits specific effects on calcium carbonate crystallization in controlled laboratory environments:

Aragonite Inhibition:

  • Strictly prohibits the precipitation of aragonite in vitro

  • In aragonite crystallization systems with high Mg²⁺ content (50 mM, mimicking extrapallial fluids), Prisilkin-39 completely inhibited the formation of needle-shaped aragonite crystals that were observed in control experiments

Calcite Regulation:

  • Does not completely inhibit calcite formation but significantly alters crystal morphology

  • Prevents the formation of typical rhombohedral calcite crystals

  • May regulate the orientation and growth of calcite crystals in the prismatic layer

Concentration Dependence:

  • The inhibitory effects show concentration-dependent behavior

  • Function as a negative regulator of aragonite growth to prevent its ectopic precipitation during shell mineralization

In Vivo Correlation:

  • The in vitro inhibitory effects correlate with in vivo observations where antibody injection against Prisilkin-39 resulted in abnormal calcium carbonate deposition

  • When the normal function of Prisilkin-39 was suppressed in vivo, large amounts of calcium carbonate were anomalously deposited from the extrapallial fluid

These findings suggest that Prisilkin-39 serves as an indispensable negative regulator during shell formation, controlling both the polymorph selection (calcite vs. aragonite) and the spatial organization of mineral deposition .

How can antibodies against Prisilkin-39 be used to study shell formation?

Antibodies against Prisilkin-39 have proven to be valuable tools for both localization studies and functional analyses:

Antibody Production:

  • Polyclonal antibodies are raised against recombinant Prisilkin-39 produced in expression systems

  • Yeast-expressed recombinant Prisilkin-39 with His-tag is purified and used as an immunogen

  • Serum containing antibodies is typically diluted 1:50 in PBS with 0.25% w/v bovine serum albumin to block nonspecific binding

Immunolocalization Applications:

  • Immunofluorescence staining: Performed on decalcified shell sections to reveal the microstructural distribution of native Prisilkin-39

    • Shells are decalcified in 0.5 M EDTA (pH 8.0) containing 4% formaldehyde and 0.5% cetylpyridinium chloride

    • Secondary antibodies conjugated with fluorescent markers (e.g., rhodamine-conjugated goat anti-rabbit) are used for visualization

  • Immune dot blot and ELISA assays: Used to detect native Prisilkin-39 in different shell matrix fractions

Functional Interference Studies:

  • In vivo antibody injection: A powerful technique to study the function of Prisilkin-39

    • Injection of anti-Prisilkin-39 antibodies into live oysters resulted in dramatic morphological deformities in the inner shell surface structure

    • Large amounts of CaCO₃ were deposited in an uncontrolled manner when Prisilkin-39 was neutralized by antibodies

    • Control injections with preimmune serum showed normal shell formation

Technical Considerations:

  • Preimmune serum should always be used as a negative control

  • Careful washing with PBS containing 0.05% Tween 20 is necessary to reduce background

  • Optimization of antibody concentration is crucial for specific binding

These immunological approaches have been instrumental in establishing the dual role of Prisilkin-39 in shell formation and demonstrating its importance in controlling calcium carbonate deposition .

What are the functional differences between Prisilkin-39 and other shell matrix proteins in Pinctada fucata?

Pinctada fucata produces numerous matrix proteins involved in shell formation, each with distinct locations and functions:

Comparison with Other Prismatic Layer Proteins:

ProteinLocationKey FeaturesFunctionContrast with Prisilkin-39
Prisilkin-39Prismatic layer, organic sheetBasic protein (pI 8.83), rich in Gly, Tyr, SerDual role: chitin binding and aragonite inhibitionUnique dual functionality
Prismalin-14Prismatic layerAcidic protein, Ala and Tyr richFramework formationLess expressed in mantle edge than Prisilkin-39
AspeinPrismatic layerExtremely acidic, Asp-richCalcite formationPromotes calcite rather than inhibiting aragonite
KRMP familyPrismatic layerLys-rich basic regionFramework constructionSimilar expression pattern but different amino acid composition
Shematrin familyPrismatic layer, shell edgeGly and Tyr richFramework formationClustered with Prisilkin-39 in expression studies

Comparison with Nacreous Layer Proteins:

ProteinLocationKey FeaturesFunctionContrast with Prisilkin-39
Prisilkin-39Prismatic layerBasic protein, inhibits aragoniteFramework formation, crystal regulationLocated in prismatic layer only
NacreinNacreous layerCarbonic anhydrase domainProvides carbonate ionsOpposite layer location, different function
MSI60Nacreous layerβ-sheet structureNacreous frameworkDifferent layer location
N16/pearlinNacreous layerAcidic, nacre-specificAragonite nucleationPromotes (not inhibits) aragonite formation
Pif97Nacreous layerAragonite bindingNacre formationDifferent layer specificity

Prisilkin-39 stands out among these proteins due to its:

  • Unique dual functionality in both framework construction and crystal growth regulation

  • Strong inhibitory effect on aragonite formation (while many nacreous proteins promote aragonite)

  • Specific localization in the organic sheet between prismatic and nacreous layers

These functional differences highlight the complex and specialized roles of various matrix proteins in the precise spatial control of shell mineralization in P. fucata .

How can gene expression analysis be used to study Prisilkin-39 in different developmental stages or under environmental conditions?

Various molecular techniques can be employed to analyze Prisilkin-39 expression patterns:

RT-PCR and qPCR Approaches:

  • Primer Design: Based on the full-length cDNA sequence of Prisilkin-39

    • Forward primers typically target unique regions to avoid cross-reactivity with other repetitive proteins

    • The 361-bp fragment amplified with primer pair YGS-T1 and YGS-T2 has been successfully used

  • Tissue Sampling: Careful separation of mantle edge (prismatic layer-forming) and pallial mantle (nacreous layer-forming) is critical for accurate expression profiling

  • Quantitative Analysis: qPCR can determine relative expression levels across different conditions

    • Normalization to appropriate reference genes is essential

    • Expression has been quantified in transcripts per million (TPM) in comparative studies

Next-Generation Sequencing Applications:

  • Transcriptome Analysis: Deep sequencing of ESTs from different mantle regions has been used to profile Prisilkin-39 expression

    • The GS FLX 454 system has been successfully employed for transcriptome sequencing

    • RNA extraction using RNeasy Lipid Tissue Mini Kit followed by 3'-fragment sequencing has provided reliable results

  • Comparative Expression Profiling: Expression can be compared across different tissues, developmental stages, or environmental conditions

    • Prisilkin-39 clusters with other prismatic layer genes in expression studies

  • Population Genetics: Genetic diversity in Prisilkin-39 can be assessed across different populations using sliding window approaches

    • Parameters such as θw, θπ, and Tajima's D values can be calculated

In Situ Hybridization for Spatial Expression:

  • Probe Generation: Digoxigenin-labeled probes generated from specific fragments using a High Prime DIG random labeling kit

  • Tissue Preparation: Fixation of mantle tissue in 4% paraformaldehyde containing 0.1% diethyl pyrocarbonate

  • Visualization: Reveals specific expression in the inner epithelial cells of the outer fold and outer epithelial cells of the middle fold

These methods have revealed that Prisilkin-39 expression is specifically localized to shell-forming tissues corresponding to the prismatic layer, with potential variations under different environmental conditions or developmental stages .

What are the current challenges in working with recombinant Prisilkin-39?

Researchers face several technical challenges when working with recombinant Prisilkin-39:

Expression and Purification Challenges:

  • Repetitive Sequence: The highly repetitive nature of Prisilkin-39 can cause:

    • PCR amplification difficulties

    • Potential recombination issues during cloning

    • Translation challenges in heterologous systems

  • Protein Folding: Ensuring proper folding of the recombinant protein

    • Yeast systems (P. pastoris) have been preferred for some studies due to advantages in protein folding and post-translational modifications

    • E. coli systems may require optimization of expression conditions to maintain functionality

Stability and Storage Issues:

  • Limited Shelf Life: Commercially available recombinant proteins have finite stability

    • Liquid form typically has a shelf life of 6 months at -20°C/-80°C

    • Lyophilized form extends shelf life to approximately 12 months

  • Freeze-Thaw Sensitivity: Repeated freezing and thawing is not recommended

    • Working aliquots should be stored at 4°C for up to one week

    • Proper reconstitution protocols must be followed

Functional Assessment Challenges:

  • Bioactivity Verification: Ensuring the recombinant protein maintains native functions

    • In vitro crystallization assays must be carefully controlled

    • Comparison with native protein is essential

  • Structural Characterization: The unusual amino acid composition makes structural determination difficult

    • High glycine, tyrosine, and serine content affects typical protein structure prediction methods

    • The repetitive regions may adopt unconventional conformations

Experimental Design Considerations:

  • Concentration Optimization: Determining appropriate protein concentrations for different assays

    • In vitro crystallization studies require careful titration

    • Antibody neutralization experiments need precise dosing

  • Buffer Compatibility: Ensuring buffer composition doesn't interfere with protein function

    • Typical storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Reconstitution conditions must be optimized for each application

These challenges highlight the importance of careful experimental design and optimization when working with this unusual matrix protein, particularly when comparing results across different recombinant forms of Prisilkin-39 .

How does Prisilkin-39 contribute to the mechanical properties of the prismatic layer?

Prisilkin-39 influences the mechanical characteristics of the prismatic layer through several mechanisms:

Organic Framework Reinforcement:

  • Forms part of the insoluble organic framework that surrounds individual calcite prisms

  • Binds tightly to chitin, creating a composite organic matrix with enhanced mechanical strength

  • Contributes to the prismatic layer's resistance to fracture by providing organic interfaces between mineral components

Crystal Orientation Control:

  • Regulates the growth of calcite crystals in the prismatic layer

  • Inhibits aragonite formation, ensuring proper polymorph selection for the prismatic layer

  • The specific orientation and arrangement of crystals directly influence the mechanical properties of the shell

Interfacial Role:

  • Located in the organic sheet (approximately 40 μm thick) between the prismatic and nacreous layers

  • This strategic position suggests a role in the transition between different mineralization patterns

  • May facilitate adhesion between the two mechanically distinct layers of the shell

Evidence from Antibody Studies:

  • When Prisilkin-39 function was disrupted through antibody injection, dramatic morphological deformities occurred in the shell structure

  • These structural abnormalities likely correspond to compromised mechanical properties

  • The uncontrolled mineral deposition observed in these experiments suggests Prisilkin-39's role in maintaining organized structural integrity

The combined effects of framework reinforcement, crystal growth regulation, and interfacial positioning make Prisilkin-39 a critical component for the prismatic layer's mechanical performance, contributing to both strength and flexibility of the composite shell structure .

What genomic approaches can be used to study Prisilkin-39 genetic diversity in different Pinctada fucata populations?

Various genomic tools can be employed to investigate Prisilkin-39 genetic diversity:

Whole Genome Sequencing Approaches:

  • Population-level Genome Sequencing: Allows comprehensive analysis of genetic variation

    • Enables calculation of population genetic parameters such as nucleotide diversity (θπ)

    • Sliding window approaches with 5 kb steps and 10 kb windows have been successfully applied

  • Fixation Index (FST) Analysis: Measures differentiation between populations

    • Can reveal selective pressures on the Prisilkin-39 gene across different environments

    • Has been used to assess genetic relationships between different P. fucata populations

Population Structure Analysis:

  • Principal Component Analysis: Reveals genetic relationships among populations

    • The top principal components explain significant variation among populations

    • Has successfully differentiated P. fucata populations in previous studies

  • Admixture Analysis: Detects population structure assuming ancestral clusters

    • Software like ADMIXTURE (version 1.3.0) with ancestral clusters ranging from 2 to 10

    • Cross-validation error analysis determines the optimal number of ancestral populations

Gene Flow and Connectivity:

  • Migration Rate Estimation: Assesses genetic connectivity between populations

    • Relative migration rates derived from Gst, Nm, and D metrics

    • Function divMigrate from R package diveRsity with bootstrap values of 1000

  • Linkage Disequilibrium Analysis: Evaluates population history and selection

    • Calculated using squared Pearson's correlation coefficient (r²)

    • Tools like PopLDdecay have been applied to P. fucata populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.