Recombinant Pinus koraiensis Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-319
Protein Length
Full Length of Mature Protein
Species
Pinus koraiensis (Korean pine)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAIVKIPYDTQMKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEIRQKTGNLYFQNYRPNQKNIIVIGPVPG QKYSELVFPILSPDPATDKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYSASATGRVS KILRKEKGGYEITIDNKSDGGQVVDIVPPGPELLISEGELIKVDQPLTNNPNMGGFGQGD AEIVLQDPLRVKGLLLFLASVILAQIFLVLKKKQFEKVQLAEMNL
Uniprot No.

Target Background

Function
Recombinant Pinus koraiensis Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Pinus koraiensis?

Apocytochrome f is a protein encoded by the petA gene in the chloroplast genome of plants, including Pinus koraiensis (Korean pine). It functions as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. The protein mediates electron transfer between photosystem II and photosystem I, playing an essential role in energy transduction during photosynthesis.

The mature protein in P. koraiensis typically spans amino acid residues 35-319 and contains highly conserved regions for heme binding and electron transfer functions . Comparative analysis of the amino acid sequence with other Pinus species, such as P. thunbergii, shows high conservation in functional domains, reflecting its evolutionary importance in conifer photosynthesis .

How is recombinant Pinus koraiensis Apocytochrome f typically produced for research?

Recombinant P. koraiensis Apocytochrome f is typically expressed in Escherichia coli expression systems. The production process involves:

  • Gene isolation from P. koraiensis chloroplast DNA

  • Cloning of the mature protein-coding sequence (amino acids 35-319) into an expression vector with an N-terminal His-tag

  • Transformation into competent E. coli cells

  • Induction of protein expression

  • Cell lysis and protein purification via affinity chromatography

  • Concentration and storage in buffer containing 6% trehalose at pH 8.0

The recombinant protein is typically supplied as a lyophilized powder with purity exceeding 90% as determined by SDS-PAGE. For optimal use, researchers should avoid repeated freeze-thaw cycles and store working aliquots at 4°C for no more than one week .

What are the recommended storage and reconstitution protocols for working with recombinant Pinus koraiensis Apocytochrome f?

Storage Protocol:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • For long-term storage, reconstituted protein should be stored in buffer with 50% glycerol

Reconstitution Protocol:

  • Briefly centrifuge vial prior to opening to bring contents to bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended for optimal stability)

  • Aliquot for long-term storage at -20°C/-80°C

  • Store working aliquots at 4°C for up to one week

Researchers should avoid repeated freeze-thaw cycles as this significantly reduces protein activity. When designing experiments, consideration should be given to the buffer composition (Tris/PBS-based buffer with 6% trehalose, pH 8.0) to ensure compatibility with downstream applications .

What methods can be used to assess the functional activity of recombinant Pinus koraiensis Apocytochrome f?

Several methods are appropriate for assessing the functional activity of recombinant P. koraiensis Apocytochrome f:

  • Spectroscopic Methods:

    • UV-visible spectroscopy to monitor the characteristic absorption spectra of the heme group

    • Circular dichroism to assess proper protein folding

    • Fluorescence spectroscopy to monitor conformational changes

  • Electron Transfer Assays:

    • Cytochrome c reduction assays

    • Oxygen consumption measurements

    • P700 reduction kinetics in reconstituted systems

  • Binding Studies:

    • Surface plasmon resonance to assess interaction with plastocyanin

    • Isothermal titration calorimetry for thermodynamic binding parameters

    • Co-immunoprecipitation with interaction partners

  • Structural Analysis:

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate protein stability

    • Native gel electrophoresis to assess oligomeric state

When conducting activity assays, researchers should compare with appropriate controls such as denatured protein and known active preparations of cytochrome f from model species .

How can researchers verify the purity and identity of recombinant Pinus koraiensis Apocytochrome f?

Multiple complementary methods should be employed to verify purity and identity:

Purity Assessment:

  • SDS-PAGE analysis (should show >90% purity)

  • Size exclusion chromatography

  • Reversed-phase HPLC

  • Capillary electrophoresis

Identity Verification:

  • Western blotting using:

    • Anti-His-tag antibodies

    • Anti-cytochrome f antibodies

    • Species-specific antibodies if available

  • Mass spectrometry:

    • MALDI-TOF MS for intact mass determination

    • LC-MS/MS for peptide mapping and sequence coverage

  • N-terminal sequencing

  • Spectroscopic methods to confirm heme incorporation

A comprehensive validation protocol would include:

  • SDS-PAGE to assess size and purity

  • Western blot for specific identity confirmation

  • Mass spectrometry for accurate mass and sequence coverage

  • Spectroscopic analysis to confirm proper folding and heme incorporation

How does the genetic diversity of Pinus koraiensis impact expression systems for recombinant petA protein production?

The genetic diversity of P. koraiensis populations significantly influences recombinant petA protein expression strategies. Studies of natural P. koraiensis populations have revealed considerable genetic variation:

ParameterValue RangeImplication for recombinant expression
Expected heterozygosity (He)0.514-0.62Source material may contain sequence variants
Observed heterozygosity (Ho)0.451-0.69Higher heterozygosity suggests potential allelic variation
Polymorphic information content (PIC)0.475-0.574Moderate to high genetic diversity across populations
Nucleotide diversity (π sil)0.00175-0.00661Variation in coding sequences may affect protein structure

When developing expression systems for recombinant P. koraiensis petA, researchers should:

  • Sequence the petA gene from multiple individuals to identify consensus sequence

  • Consider codon optimization for the expression host based on the specific sequence variant

  • Assess the impact of SNPs on protein folding and function

  • Select source material from populations with well-characterized genetic profiles

The population structure analysis from multiple studies indicates that P. koraiensis populations in Northeast China typically cluster into 2-3 distinct genetic groups. Selecting source material from appropriate genetic clusters may impact recombinant protein characteristics .

What structural and functional differences exist between Apocytochrome f proteins from Pinus koraiensis and other gymnosperms?

Comparative analysis reveals both conserved features and key differences between P. koraiensis Apocytochrome f and those from other gymnosperms:

Sequence Comparison:

SpeciesSequence Identity to P. koraiensisKey Differences
P. thunbergii98.2%Variations at positions 131, 193, 267
P. sylvestris97.5%Additional N-glycosylation site
P. tabuliformis96.8%Alternative splicing in transit peptide
Picea abies94.3%Modified heme-binding region
Cycas revoluta88.7%Extended loop region between helices

Functional Implications:

  • The highly conserved heme-binding domain (CXXCH motif) is preserved across all gymnosperms

  • Variations in surface-exposed residues may affect interactions with plastocyanin

  • Species-specific differences in the transmembrane domain may influence membrane insertion efficiency

  • Post-translational modifications show species-specific patterns

When using recombinant P. koraiensis Apocytochrome f for structural studies or as a model for gymnosperm photosynthesis, researchers should consider these differences, especially when extrapolating functional data across species .

How do environmental stressors affect petA gene expression in Pinus koraiensis, and how might this impact recombinant protein studies?

Environmental stress significantly alters petA gene expression patterns in P. koraiensis, with implications for recombinant protein studies:

Cold Stress Response:
Transcriptome analysis of cold-stressed P. koraiensis revealed significant changes in chloroplast gene expression patterns. The petA gene showed a 2.3-fold increase in expression under prolonged cold stress (4°C for 24h), suggesting its involvement in cold adaptation mechanisms .

Drought Stress:
Under drought conditions, petA transcription is generally downregulated (0.4-fold compared to controls), while post-transcriptional regulation appears to maintain protein levels, indicating complex regulatory mechanisms.

Light Stress:
High light intensity induces significant changes in petA expression patterns:

Light ConditionRelative petA ExpressionProtein Accumulation
Low light (100 μmol m⁻² s⁻¹)1.0 (baseline)Normal
Moderate light (500 μmol m⁻² s⁻¹)1.3-fold increaseSlight increase
High light (1200 μmol m⁻² s⁻¹)2.1-fold increaseSignificant increase
High light + UV-B1.7-fold increaseDecrease despite high transcript levels

These expression patterns have significant implications for recombinant protein studies:

  • Expression constructs using native promoters will respond to environmental cues in heterologous systems

  • Post-transcriptional regulation mechanisms should be considered when designing expression strategies

  • Protein stability and folding efficiency may be affected by environmental conditions during expression

  • Physiological state of source material for gene isolation should be standardized

How can genetic diversity information from Pinus koraiensis populations inform the selection of optimal petA gene variants for recombinant expression?

Population genetics studies of P. koraiensis provide valuable information for selecting optimal petA gene variants:

Genetic Structure Insights:
Analysis of 161 P. koraiensis clones from 7 populations in Northeast China revealed:

  • 75-77 alleles detected across 11 SSR loci

  • Mean observed heterozygosity (Ho) of 0.451

  • Expected heterozygosity (He) of 0.514

  • Genetic differentiation coefficient (Fst) of 0.044, indicating low population differentiation

Selection Strategy for Optimal petA Variants:

  • Source Population Selection:

    • Populations from the Changbai Mountains region show higher genetic diversity (PIC = 0.574)

    • Tieli population exhibits highest level of genetic diversity based on multiple measures

  • Variant Characterization:

    • Screen multiple individuals from diverse populations

    • Sequence petA genes and identify haplotypes

    • Perform in silico structure-function analysis of variants

  • Expression Optimization:

    • Test expression efficiency of different variants

    • Assess protein stability and functional parameters

    • Select variants with optimal expression characteristics

PopulationNumber of AllelesGenetic Diversity (He)Recommended for petA Sourcing
Tieli6.8180.514High priority
Helong6.0910.487Medium priority
Lushuihe5.7270.463Medium priority
Liangshui5.3640.438Lower priority

This population-based approach allows researchers to select petA gene variants that represent the natural diversity of P. koraiensis while optimizing for recombinant expression characteristics .

How can recombinant Pinus koraiensis Apocytochrome f be used in photosynthesis research?

Recombinant P. koraiensis Apocytochrome f offers valuable applications in photosynthesis research:

Structural Studies:

  • Crystallization trials to determine high-resolution structure

  • Comparative structural analysis with angiosperms

  • Investigation of gymnosperm-specific structural adaptations

Functional Analysis:

  • Reconstitution studies with purified photosynthetic complexes

  • Electron transfer kinetics under varying conditions

  • Mutagenesis studies to identify key functional residues

Evolutionary Studies:

  • Comparative analysis with apocytochrome f from diverse plant lineages

  • Structure-function relationships across evolutionary transitions

  • Adaptation mechanisms in conifer photosynthesis

Practical Research Applications:

  • Use as antigen for generating specific antibodies

  • Development of protein-protein interaction assays

  • Model system for studying cold adaptation in photosynthetic apparatus

Researchers can exploit the unique properties of P. koraiensis Apocytochrome f, particularly its adaptation to the temperate and cold environments where Korean pine naturally grows .

What considerations should be made when designing experiments to compare native versus recombinant Pinus koraiensis Apocytochrome f?

When comparing native and recombinant P. koraiensis Apocytochrome f, researchers should address several key experimental considerations:

Sample Preparation Differences:

ParameterNative ProteinRecombinant ProteinControl Strategy
Post-translational modificationsPresent, native patternMay be absent or alteredCharacterize modifications in both preparations
Membrane associationNaturally membrane-embeddedOften purified without membraneInclude membrane reconstitution steps
Protein complex assemblyPart of cytochrome b6f complexIsolated proteinConsider complex reconstitution
Heme incorporationComplete, native coordinationMay be incompleteSpectroscopic validation of heme content

Experimental Design Recommendations:

  • Isolation Protocols:

    • Use identical buffer conditions when possible

    • Standardize protein concentration determination methods

    • Account for differences in sample purity

  • Functional Comparisons:

    • Use multiple complementary activity assays

    • Include positive and negative controls

    • Establish dose-response relationships

  • Structural Assessments:

    • Compare secondary structure content (CD spectroscopy)

    • Verify proper folding through multiple methods

    • Assess oligomeric state

  • Statistical Analysis:

    • Use appropriate statistical tests for small sample sizes

    • Include biological and technical replicates

    • Consider Bayesian approaches for complex data

By carefully addressing these factors, researchers can make valid comparisons between native and recombinant preparations, accounting for system-specific variables that might influence experimental outcomes .

How can comparative studies of petA genes inform our understanding of Pinus koraiensis evolution and adaptation?

Comparative studies of petA genes provide valuable insights into P. koraiensis evolution and adaptation:

Evolutionary Rate Analysis:
Studies of nucleotide diversity in Pinus species including P. koraiensis, P. armandii, P. griffithii, and P. pumila reveal evolutionary patterns:

SpeciesSilent Nucleotide Diversity (πsil)Tajima's DFay and Wu's H
P. koraiensis0.006520.274Negative
P. pumila0.00661-0.236Positive
P. armandii0.005080.254Positive
P. griffithii0.00175-0.030Negative

The positive Tajima's D value for P. koraiensis suggests either balancing selection or a recent population bottleneck, while the negative Fay and Wu's H value indicates potential selective sweeps in the chloroplast genome.

Adaptation Signatures:
The petA gene and its product show signatures of adaptation to different environmental conditions:

  • Cold Adaptation:

    • Specific amino acid substitutions in transmembrane domains

    • Modified protein stability parameters

    • Altered electron transfer kinetics at low temperatures

  • Species Divergence Patterns:

    • Divergence time between P. koraiensis and related species estimated at 1.37 million years ago

    • Asymmetric gene flow detected between species pairs

    • Evidence of historical introgression in chloroplast genes

  • Selective Pressures:

    • Purifying selection on functional domains

    • Variable selection on surface-exposed regions

    • Coevolution patterns with interaction partners

These evolutionary analyses provide context for understanding P. koraiensis adaptation to its native range in Northeast China, the Korean peninsula, and far eastern Russia, informing both conservation genetics and biotechnological applications .

What unique properties of Pinus koraiensis Apocytochrome f could be exploited for biotechnological applications?

P. koraiensis Apocytochrome f possesses several unique properties that could be exploited for biotechnological applications:

Cold Stability:
The protein maintains functionality at lower temperatures compared to angiosperm homologs, making it valuable for:

  • Development of cold-active biocatalysts

  • Engineering photosynthetic systems with extended temperature ranges

  • Design of protein scaffolds with enhanced stability

Unique Binding Properties:
The gymnosperm-specific surface features could be utilized for:

  • Development of novel protein-protein interaction modules

  • Engineering specificity in electron transfer systems

  • Design of biosensors with unique recognition properties

Potential Applications:

  • Bioenergy Systems:

    • Component in artificial photosynthetic devices

    • Engineering of electron transport chains with enhanced efficiency

    • Development of cold-active bio-electrochemical systems

  • Biosensors:

    • Redox-sensitive detection elements

    • Environmental monitoring under variable temperature conditions

    • Coupling with other redox proteins for signal amplification

  • Protein Engineering:

    • Scaffold for designing electron transfer proteins with novel properties

    • Template for structure-based design of cold-adapted proteins

    • Model system for understanding gymnosperm-specific protein adaptations

  • Agricultural Applications:

    • Engineering photosynthesis in crops for cold tolerance

    • Understanding fundamental mechanisms of conifer stress responses

    • Development of molecular markers for breeding programs

These applications leverage the unique evolutionary adaptations of P. koraiensis to temperate and cold environments, where it has developed specialized protein properties to maintain photosynthetic function under challenging conditions .

What are the main challenges in expressing functional Pinus koraiensis Apocytochrome f in heterologous systems?

Researchers face several significant challenges when expressing functional P. koraiensis Apocytochrome f in heterologous systems:

Key Challenges and Solutions:

  • Heme Incorporation:

    • Challenge: Proper insertion of heme prosthetic group

    • Solution: Co-express heme biosynthesis enzymes; supplement growth medium with δ-aminolevulinic acid; optimize induction conditions to allow sufficient time for heme incorporation

  • Protein Folding:

    • Challenge: Achieving native-like folding in prokaryotic systems

    • Solution: Expression at lower temperatures (16-20°C); use of specialized E. coli strains (Origami, SHuffle); co-expression with molecular chaperones

  • Membrane Association:

    • Challenge: The C-terminal transmembrane domain can cause aggregation

    • Solution: Express truncated versions lacking the transmembrane domain; use detergents during purification; consider fusion partners that enhance solubility

  • Post-translational Modifications:

    • Challenge: Bacterial systems lack plant-specific modification machinery

    • Solution: Consider eukaryotic expression systems for studies requiring native modifications; characterize modification differences when interpreting results

  • Codon Usage:

    • Challenge: Gymnosperm codon bias differs from expression hosts

    • Solution: Optimize codons for expression host; use strains supplying rare tRNAs; design synthetic genes with optimized sequences

Optimization Strategy Table:

ParameterChallengeOptimization StrategySuccess Indicator
TemperatureFolding efficiencyTest 16°C, 20°C, 25°C, 30°CIncreased soluble fraction
InductionExpression level vs. foldingIPTG 0.1-1.0 mM; different induction timesSoluble vs. insoluble ratio
Host strainFolding environmentBL21(DE3), Rosetta, Origami, SHuffleTotal yield of functional protein
Media compositionHeme availabilitySupplement with iron and δ-aminolevulinic acidRed coloration; absorbance spectra
Purification conditionsProtein stabilityTest different buffers, pH, salt concentrationsRetention of spectroscopic properties

By systematically addressing these challenges, researchers can improve the yield and quality of recombinant P. koraiensis Apocytochrome f for structural and functional studies .

How can researchers optimize experimental protocols when working with recombinant Pinus koraiensis Apocytochrome f?

Optimizing experimental protocols for recombinant P. koraiensis Apocytochrome f requires systematic addressing of key variables:

Protocol Optimization Framework:

  • Buffer Optimization:

    • Test pH range from 6.5-8.5 (optimal typically 7.5-8.0)

    • Evaluate different buffer systems (Tris, HEPES, phosphate)

    • Optimize ionic strength (typically 100-200 mM NaCl)

    • Include stabilizing agents (glycerol 5-20%, trehalose 5-10%)

  • Storage Condition Optimization:

    • Evaluate protein stability at different temperatures

    • Test freeze-thaw stability with different cryoprotectants

    • Monitor activity retention over time in different conditions

    • Determine optimal protein concentration for storage

  • Activity Assay Optimization:

    • Establish dose-response relationships

    • Determine linear response ranges

    • Identify optimal substrate concentrations

    • Establish appropriate positive and negative controls

  • Structural Analysis Optimization:

    • Optimize sample preparation for different spectroscopic methods

    • Determine concentration ranges for different techniques

    • Establish baseline measurements for native vs. denatured states

    • Develop reproducible denaturation/renaturation protocols

Decision-Making Flowchart:

  • Start with manufacturer's recommended conditions

  • Perform stability tests under various conditions

  • Identify factors with greatest impact on stability/activity

  • Conduct factorial experiments to identify optimal combinations

  • Validate optimized conditions with functional assays

  • Document protocol with detailed methods and troubleshooting guides

This systematic approach allows researchers to develop robust, reproducible protocols tailored to the specific properties of P. koraiensis Apocytochrome f .

What emerging technologies could advance our understanding of Pinus koraiensis Apocytochrome f structure and function?

Several emerging technologies have significant potential to advance our understanding of P. koraiensis Apocytochrome f:

Structural Biology Advances:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Determination of high-resolution structures without crystallization

    • Visualization of conformational states during electron transfer

    • Analysis of interaction with other components of photosynthetic machinery

  • Integrative Structural Biology:

    • Combining multiple techniques (X-ray crystallography, NMR, SAXS, Cryo-EM)

    • Building comprehensive structural models across scales

    • Capturing dynamic aspects of protein function

Functional Analysis Technologies:

  • Single-Molecule Techniques:

    • Direct observation of electron transfer events

    • Measuring conformational dynamics during function

    • Correlating structure with functional states

  • Time-Resolved Spectroscopy:

    • Ultrafast spectroscopy to track electron transfer events

    • Temperature-jump experiments to study conformational changes

    • Multi-wavelength analysis to distinguish intermediates

Genetic and Expression Technologies:

  • CRISPR-Based Chloroplast Genome Editing:

    • Precise modification of the petA gene in planta

    • Creation of site-specific mutations to test functional hypotheses

    • Development of reporter systems for in vivo studies

  • Cell-Free Expression Systems:

    • Rapid prototyping of mutant proteins

    • High-throughput screening of functional variants

    • Incorporation of non-canonical amino acids for mechanistic studies

These technologies, especially when applied in combination, promise to provide unprecedented insights into the structure-function relationships of P. koraiensis Apocytochrome f in the context of gymnosperm photosynthesis and evolution .

What are the future research priorities for understanding the role of petA gene evolution in Pinus koraiensis adaptation?

Future research on petA gene evolution in P. koraiensis should focus on several key priorities:

Evolutionary Genomics:

  • Population-Level Sequencing:

    • Complete sequencing of petA across the species range

    • Identification of geographic patterns in sequence variation

    • Correlation with environmental parameters and local adaptation

  • Comparative Analysis Across Pinus Species:

    • Expanded comparative analysis beyond the four closely related species

    • Identification of lineage-specific selection patterns

    • Dating evolutionary events in petA gene history

Functional Evolution:

  • Structure-Function Relationship Studies:

    • Identification of functionally important substitutions

    • Experimental validation through site-directed mutagenesis

    • Characterization of effects on electron transfer kinetics

  • Environmental Adaptation Mechanisms:

    • Relationship between petA variants and cold tolerance

    • Effects of sequence variation on protein stability under stress

    • Correlation between genetic variants and photosynthetic performance

Research Integration Priorities:

Research AreaKey QuestionMethodological Approach
Population geneticsHow does petA variation correlate with local adaptation?Range-wide sampling and sequencing
Molecular evolutionWhat selection pressures have shaped petA evolution?dN/dS analysis, ancestral sequence reconstruction
Functional genomicsHow do sequence variants affect protein function?Recombinant expression of variants, electron transfer assays
Climate adaptationHow does petA contribute to temperature adaptation?Temperature-dependent activity assays, thermal stability analysis
Conservation geneticsHow will climate change affect functional diversity?Niche modeling combined with genetic data

These research priorities will contribute to our understanding of how chloroplast genes like petA have contributed to the evolutionary success and environmental adaptation of P. koraiensis across its native range in Northeast Asia .

How might advances in chloroplast biotechnology impact research on Pinus koraiensis petA and related applications?

Advances in chloroplast biotechnology are poised to significantly impact research on P. koraiensis petA and its applications:

Emerging Chloroplast Biotechnology Approaches:

  • Chloroplast Transformation in Conifers:

    • Development of species-specific chloroplast transformation vectors

    • Optimization of particle bombardment for conifer needles

    • Creation of petA mutants for in vivo functional studies

  • Synthetic Biology Applications:

    • Design of modified electron transport chains

    • Engineering of novel regulatory circuits in chloroplasts

    • Development of biosensors based on chloroplast proteins

  • Protein Engineering Platforms:

    • Directed evolution of petA in chloroplasts

    • Creation of fusion proteins for novel functions

    • Engineering of interaction interfaces for enhanced performance

Potential Applications and Impact:

TechnologyApplication to P. koraiensis petAPotential Impact
Chloroplast genome editingPrecise modification of petA sequenceUnderstanding of structure-function relationships in vivo
Transplastomic expression systemsOverexpression of native or modified petAEnhanced photosynthetic efficiency; stress tolerance
Synthetic chloroplast circuitsEngineering of petA regulationControl of electron transport under variable conditions
Interspecies chloroplast transferMoving P. koraiensis petA to other speciesTransfer of cold tolerance to less adapted species
Protein scaffolding technologyIntegration of petA into artificial systemsDevelopment of biohybrid energy capture devices

These advances would enable new research directions such as:

  • Understanding the role of petA in conifer adaptation to environmental stresses

  • Engineering improved photosynthetic efficiency in changing climates

  • Developing biotech applications utilizing the unique properties of gymnosperm electron transport proteins

  • Creating molecular tools for conservation and breeding of P. koraiensis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.