Recombinant Pinus koraiensis ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pinus koraiensis ATP Synthase Subunit b, Chloroplastic (atpF)

Recombinant Pinus koraiensis ATP synthase subunit b, chloroplastic (atpF) refers to a synthetically produced version of the ATP synthase subunit b protein, specifically from the Korean pine (Pinus koraiensis) and targeted to the chloroplast. ATP synthase is an essential enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency of cells, through oxidative phosphorylation and photophosphorylation . In plants, ATP synthase is found in both mitochondria and chloroplasts . The atpF subunit is a component of the ATP synthase complex located in the chloroplast, playing a crucial role in its structure and function . The recombinant form of this protein is produced using genetic engineering techniques, typically in a host organism like Escherichia coli, for research and industrial applications .

Protein Information

CategoryDescription
NameRecombinant Full Length Atp Synthase Subunit B, Chloroplastic(Atpf) Protein, His-Tagged
SourcePinus koraiensis (Korean pine)
TypeATP Synthase Subunit
LocationChloroplast
Production HostE. coli
TagN-terminal His tag
Protein Length1-178 amino acids
Accession NumberQ1KVY1

Function and Significance

  1. ATP Synthesis: ATP synthase, also known as F-ATPase, is a vital enzyme that catalyzes the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate (Pi) using the proton gradient generated across the thylakoid membrane in chloroplasts .

  2. Subunit Composition: The ATP synthase complex consists of two main components: CF1 and CF0. The CF1 component is located on the stromal side of the thylakoid membrane and contains the catalytic subunits. The CF0 component is embedded in the thylakoid membrane and forms a proton channel. The atpF subunit is a part of the CF0 complex, specifically contributing to the structural integrity and proton translocation function of the ATP synthase .

  3. Role in Photosynthesis: During the light-dependent reactions of photosynthesis, light energy is used to generate a proton gradient across the thylakoid membrane. This gradient drives the flow of protons through the ATP synthase, leading to the synthesis of ATP. The atpF subunit is essential for maintaining the proton channel's structure and ensuring efficient ATP production .

Production and Applications of Recombinant atpF

  1. Recombinant Production: The recombinant form of the atpF subunit is typically produced in E. coli cells. The gene encoding the atpF subunit from Pinus koraiensis is cloned into an expression vector and introduced into E. coli . The bacteria are then cultured under conditions that induce protein expression. The recombinant protein is purified using affinity chromatography, often employing a His tag fused to the N-terminus of the protein .

  2. Research Applications:

    • Structural Studies: Recombinant atpF can be used for structural studies to understand its role in the ATP synthase complex. Techniques such as X-ray crystallography and cryo-electron microscopy can provide detailed structural information .

    • Functional Analysis: The recombinant protein allows researchers to perform in vitro functional assays to study the proton translocation and ATP synthesis activity of the enzyme .

    • Antibody Production: Recombinant atpF can be used as an antigen to generate specific antibodies. These antibodies are valuable tools for studying the localization and expression of the atpF subunit in plants .

Research Findings and Related Studies

  1. Impact of ATP Levels on Plant Metabolism: Studies on Arabidopsis thaliana have shown that altering ATP levels in chloroplasts and mitochondria can significantly impact plant metabolism. Overexpression of purple acid phosphatase 2 (AtPAP2), which increases ATP levels, affects the transcription and protein abundances of genes encoded by organellar genomes .

  2. Interaction with Transcription Factors: Research on Pinus massoniana has identified proteins that interact with the promoter of the PmACRE1 gene, including ATP synthase subunits. These interactions suggest a role in defense mechanisms against pathogens .

  3. Subcellular Localization: Subcellular localization studies of related proteins, such as the PmMYB8 transcription factor in P. massoniana, have shown that these proteins are localized in the nucleus, indicating their role in regulating gene expression related to plant defense and metabolism .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Pinus koraiensis (Korean pine)
Target Names
atpF
Target Protein Sequence
MKNVIDPFISLSYWPSAGGFGSNTNILETNIINPSVVLSVLIYFGKGVLSNLLDNRKQKI LNTIRNSEELCKGAIDQLEKARARLREVEMIGDEIRVNGDSQVEREKEDLINAASENLEQ LEDPKNETIYSEQQRAIDQIRQQVSRQALRRTIGTLNSRFKIELHLRTINQNIGLFRTMM NTPD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extra-membraneous) and the F(0) membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit b (atpF) in chloroplastic energy production?

ATP synthase subunit b (atpF) is a critical component of the F₀ sector of the chloroplastic ATP synthase complex. This protein plays a dual structural and functional role:

  • Functions as part of the peripheral stalk that connects the F₁ catalytic domain to the membrane-embedded F₀ sector

  • Provides structural stability to maintain the integrity of the entire complex

  • Prevents rotation of the α₃β₃ hexamer during catalytic activity

  • Contributes to the proton channel formation necessary for ATP synthesis

How do the expression patterns and regulations of atpF differ in Pinus koraiensis compared to model plant systems?

Pinus koraiensis, like other coniferous species, exhibits unique expression patterns of chloroplastic genes including atpF:

  • Transcriptomic analyses reveal that ATP synthase subunit genes in P. koraiensis show differential expression patterns under various environmental stresses, particularly cold stress

  • Unlike model plant systems such as Arabidopsis, P. koraiensis maintains high expression levels of photosynthetic machinery genes (including ATP synthase components) even under extreme cold stress (-20°C)

  • The global transcriptome profiles generated for P. koraiensis revealed over 123,445 unigenes, among which ATP synthase-related genes showed significant differential expression under cold stress conditions

A notable distinction is that while atpF expression in model plants typically decreases under extreme stress conditions, P. koraiensis appears to maintain functional photosynthetic machinery even under severe cold, suggesting specialized regulatory mechanisms adapted to its native cold environments.

What are the recommended protocols for recombinant expression and purification of Pinus koraiensis atpF protein?

Based on successful protocols established for other P. koraiensis chloroplastic proteins, the following methodological approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) is the preferred expression system for P. koraiensis chloroplastic proteins

  • The pET vector system with an N-terminal His-tag facilitates purification while minimizing interference with protein function

Optimization Protocol:

  • Clone the full-length atpF gene from P. koraiensis into a pET expression vector

  • Transform into E. coli BL21(DE3)

  • Induce expression with 0.5-1.0 mM IPTG at 16-18°C for 16-20 hours (low temperature induction improves proper folding)

  • Lyse cells in Tris/PBS-based buffer with 6% trehalose (pH 8.0)

  • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

Storage Recommendations:

  • Store as lyophilized powder or in Tris/PBS-based buffer with 50% glycerol at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

How does phosphorylation affect the function of ATP synthase b subunit, and what are the implications for regulatory mechanisms in Pinus koraiensis?

Phosphorylation of ATP synthase subunits has emerged as a significant post-translational regulatory mechanism with profound functional consequences. Research on the β subunit provides insights that may be applicable to the b subunit:

  • Phosphorylation can alter both assembly and activity of the ATP synthase complex

  • Multiple phosphorylation sites can have distinct and sometimes opposing effects

Key Experimental Findings from Analogous Research:

Phosphorylated residue positionPhospho-mimetic mutant effectNon-phosphorylatable mutant effectFunctional impact
T58Reduced ATPase rate (1.43±0.25 μmoles Pi/mg/min)Partial reduction in ATPase rate (2.42±0.38 μmoles Pi/mg/min)Affects dimer formation/maintenance
S213No significant effect (3.14±0.51 μmoles Pi/mg/min)No significant effect (3.44±0.52 μmoles Pi/mg/min)Minimal impact on function
T262Complete abolishment of activityNormal activity (4.01±0.36 μmoles Pi/mg/min)Critically regulates catalytic function
T318No detectable activitySeverely reduced activity (0.17±0.15 μmoles Pi/mg/min)Essential for complex activity

Based on these findings, researchers investigating P. koraiensis atpF should:

  • Identify potential phosphorylation sites using computational prediction tools

  • Generate phospho-mimetic (Asp/Glu substitution) and non-phosphorylatable (Ala substitution) mutants

  • Assess effects on complex assembly, stability, and activity

  • Investigate whether phosphorylation changes under stress conditions relevant to P. koraiensis' natural environment

What role does the atpF subunit play in cold stress response mechanisms in Pinus koraiensis, and how might it contribute to freeze tolerance?

P. koraiensis exhibits remarkable cold tolerance down to -20°C, making it an excellent model for studying cold adaptation mechanisms in conifers. Transcriptomic analyses reveal potential roles for ATP synthase components in this adaptation:

  • Global transcriptome profiling identified 9842 differentially expressed genes (DEGs) after 6 hours, 9250 after 24 hours, and 9697 after 48 hours of cold stress at -20°C

  • ATP synthase-related genes show distinct expression patterns during cold stress, suggesting functional relevance to cold adaptation

Proposed Mechanisms:

  • Structural modifications: Cold-adapted atpF may maintain structural flexibility at low temperatures, preserving ATP synthase function

  • Energy balance regulation: atpF modifications may adjust ATP production rates to match reduced metabolic demands during cold stress

  • ROS management: ATP synthase components may interact with antioxidant mechanisms to mitigate cold-induced oxidative stress

  • Membrane integrity maintenance: atpF could contribute to stabilizing thylakoid membrane structure at low temperatures

Research methodologies to explore these hypotheses should include:

  • Comparative analysis of atpF sequences between cold-tolerant (P. koraiensis) and cold-sensitive pine species

  • Assessment of protein-protein interactions between atpF and cold-responsive proteins

  • Measurement of ATP synthesis rates in isolated chloroplasts under cold stress conditions

  • Evaluation of membrane fluidity and integrity in wild-type versus atpF-modified systems

How can researchers distinguish between proton-driven and potassium-driven ATP synthesis in recombinant ATP synthase systems containing P. koraiensis atpF?

Recent research has revealed that ATP synthase can utilize both H⁺ and K⁺ gradients to drive ATP synthesis, challenging the traditional view of exclusively proton-driven synthesis. This finding has significant implications for understanding P. koraiensis energy metabolism:

Experimental Approach for Distinguishing Ion-Specific ATP Synthesis:

  • Reconstituted Proteoliposome System:

    • Incorporate purified recombinant P. koraiensis ATP synthase containing atpF into liposomes

    • Use the K⁺-sensitive fluorescent dye PBFI trapped inside vesicles to monitor K⁺ flux

  • Ion Selectivity Measurements:

    • Create defined gradients of either H⁺ or K⁺ across the membrane

    • Use protonophore FCCP to dissipate H⁺ gradients when measuring K⁺-specific effects

    • Employ specific inhibitors: venturicidin B (F₀ inhibitor) and 5-hydroxydecanoate (mKATP blocker)

  • Quantification Methods:

    • Measure ATP synthesis rates using bioluminescence photon detection

    • Simultaneously measure unitary K⁺ currents by voltage clamp techniques

    • Calculate ion-specific contributions using GHK formulation

Expected Results Interpretation:
Under physiological conditions (pH=7.2, K⁺=140 mEq/L), ATP synthase may conduct approximately 3.7 K⁺ ions for every H⁺ ion due to the >10⁶-fold excess of cytoplasmic K⁺ over H⁺ .

Data show that K⁺-driven ATP synthesis rates can be significantly enhanced by potassium channel openers like diazoxide, and this enhancement is blocked by specific F₀ inhibitors, demonstrating direct involvement of the ATP synthase complex in K⁺ transport .

What conservation patterns are observed in atpF sequences across conifer species, and what functional constraints might these suggest?

Comparative analysis of atpF sequences across conifer species reveals important conservation patterns that suggest functional constraints on this protein:

Sequence Conservation Analysis:

  • P. koraiensis chloroplastic proteins show high sequence homology with other pine species, particularly within functional domains

  • The amino acid sequences of ATP synthase subunits are highly conserved across conifers, reflecting their essential role in energy metabolism

Genetic Diversity Analysis in P. koraiensis:
Studies examining genetic diversity in P. koraiensis populations provide context for understanding conservation patterns:

Population TypeExpected Heterozygosity (He)Observed Heterozygosity (Ho)FST Value
Maternal Populations0.6170.6850.029
Progeny Populations0.6320.6890.025

This relatively high genetic diversity (He > 0.6) compared to other pine species suggests that while essential functional domains remain conserved, P. koraiensis maintains adaptive genetic variation .

Research Approaches to Investigate Functional Constraints:

  • Perform site-specific evolutionary rate analysis to identify positively or negatively selected residues

  • Compare sequence variability between membrane-spanning and solvent-exposed regions

  • Analyze co-evolution patterns with interacting ATP synthase subunits

  • Correlate sequence conservation with structural elements from homology models

  • Test functional effects of mutations at highly conserved versus variable residues

How can researchers optimize heterologous expression systems for chloroplastic proteins like atpF from conifers?

Expressing conifer chloroplastic proteins in heterologous systems presents several challenges, including codon bias, protein folding, and post-translational modifications. Based on successful protocols for other P. koraiensis proteins, researchers should consider:

Optimization Strategies:

  • Expression System Selection:

    • E. coli BL21(DE3) remains the preferred host for initial trials

    • Consider cold-adapted E. coli strains for improved folding of proteins from cold-tolerant species

    • For complex fold requirements, explore Pichia pastoris or insect cell systems

  • Vector and Tag Design:

    • Use strong but controllable promoters (T7, tac)

    • N-terminal His-tag provides efficient purification while minimizing interference

    • For membrane-associated domains, consider fusion partners (MBP, SUMO) to enhance solubility

  • Expression Conditions:

    • Low-temperature induction (16-18°C) improves proper folding

    • Addition of osmolytes (trehalose, glycerol) enhances stability

    • Co-expression with chloroplastic chaperones may improve folding

  • Validation Methods:

    • SDS-PAGE and western blotting to confirm expression

    • Circular dichroism to verify secondary structure

    • Functional assays specific to ATP synthase activity

What techniques can be used to investigate the interaction between atpF and other ATP synthase subunits in reconstructed systems?

Understanding subunit interactions is crucial for elucidating the assembly and function of ATP synthase. For researchers studying P. koraiensis atpF, several state-of-the-art techniques are recommended:

In Vitro Interaction Analysis:

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged versions of atpF and potential interacting partners

    • Use antibodies against the tag to pull down protein complexes

    • Identify interacting partners by mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified atpF on a sensor chip

    • Flow solutions containing other subunits over the chip

    • Measure binding kinetics and affinity constants

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse split fluorescent protein fragments to atpF and potential partners

    • Co-express in a suitable system

    • Reconstitution of fluorescence indicates interaction

Structural Analysis:

  • Blue Native-PAGE:

    • Analyze intact complexes under non-denaturing conditions

    • Identifies different assembly states (monomers, dimers, subcomplexes)

    • Can be combined with in-gel activity assays to correlate structure with function

  • Cryo-Electron Microscopy:

    • Visualize 3D structure of the complete ATP synthase complex

    • Determine the position and interactions of atpF

    • Compare wild-type and mutant structures

Functional Correlation:

  • Reconstitution Experiments:

    • Reconstitute ATP synthase complexes with wild-type or mutant atpF

    • Measure ATP synthesis and hydrolysis rates

    • Correlate functional changes with structural alterations

Research using these approaches has demonstrated that phosphorylation of ATP synthase subunits can dramatically affect complex assembly and activity. For example, phospho-mimetic mutations at specific residues can abolish ATPase activity while non-phosphorylatable mutations maintain normal activity .

What are the methodological approaches for investigating the role of atpF in stress response mechanisms beyond cold tolerance in Pinus koraiensis?

P. koraiensis faces multiple environmental stresses beyond cold, including drought, oxidative stress, and pathogen attacks. Investigating atpF's role in these responses requires integrated approaches:

Transcriptomic Analysis:

  • RNA-seq under various stress conditions (drought, high light, pathogens)

  • Compare atpF expression patterns across stress types

  • Identify co-expressed genes that may function in the same pathways

Proteomic Investigation:

  • Analyze post-translational modifications of atpF under different stresses

  • Identify stress-specific interaction partners

  • Quantify protein abundance changes in response to stress

Physiological Measurements:

  • Compare ATP synthesis rates in chloroplasts isolated from stressed and control plants

  • Measure photosynthetic parameters (Fv/Fm, NPQ) in relation to ATP synthase function

  • Assess ROS production and antioxidant capacity in wild-type versus atpF-modified systems

Case Study: Metabolic Changes in P. koraiensis After Supplementation:
Recent research investigating metabolic responses in animals supplemented with P. koraiensis essential oil revealed:

Metabolic FunctionsStatus in ControlStatus After PEO TreatmentP-value
Citrate cycle (TCA cycle)EnrichedReduced0.069
Glycolysis/gluconeogenesisEnrichedReduced0.078
Propionate metabolismEnrichedReduced0.059
Pyruvate metabolismEnrichedReduced0.017
Ascorbate and aldarate metabolismReducedEnriched0.022
Galactose metabolismReducedEnriched0.023
Pentose and glucuronate interconversionsReducedEnriched0.008
Starch and sucrose metabolismReducedEnriched0.019

These metabolic shifts demonstrate P. koraiensis compounds can significantly alter energy metabolism pathways, suggesting ATP synthase components may be involved in regulatory responses beyond primary energy production .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.