Recombinant Pinus koraiensis Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pinus koraiensis Chloroplast Envelope Membrane Protein (cemA)

Recombinant Pinus koraiensis Chloroplast Envelope Membrane Protein (cemA) is a protein derived from the chloroplast envelope membrane of Pinus koraiensis, a species of pine tree. This protein is produced through recombinant DNA technology, where the gene encoding the protein is inserted into a host organism, such as Escherichia coli (E. coli), to produce large quantities of the protein. The chloroplast envelope membrane plays a crucial role in the functioning of chloroplasts, which are essential for photosynthesis in plants.

Function and Importance of Chloroplast Envelope Membrane Proteins

Chloroplast envelope membrane proteins are involved in various critical functions, including:

  • Ion and Metabolite Transport: These proteins facilitate the movement of ions and metabolites across the chloroplast envelope, which is essential for photosynthesis and other chloroplast functions .

  • Protein Import Machinery: Proteins in the envelope membrane help in importing proteins synthesized in the cytosol into the chloroplast .

  • Chloroplast Lipid Metabolism: They are involved in the synthesis and regulation of chloroplast lipids, which are crucial for maintaining membrane structure and function .

Data Table: Characteristics of Recombinant Chloroplast Envelope Membrane Proteins

CharacteristicDescription
Source OrganismPinus koraiensis (for cemA)
Expression HostTypically Escherichia coli
PurityOften greater than 90%
TagHis-tag for purification and detection
FunctionInvolved in chloroplast envelope membrane functions

References PubMed: Proteomics of the chloroplast envelope membranes from Arabidopsis thaliana. Frontiers in Plant Science: Dynamic Remodeling of the Plastid Envelope Membranes. PMC: New Cembranolides from the Dongsha Atoll Soft Coral Lobophytum durum. Creative Biomart: Recombinant Full Length Pinus thunbergii Chloroplast Envelope Membrane Protein(cemA) Protein, His-Tagged. Colorectal Research: ELISA Recombinant Pinus koraiensis Chloroplast envelope membrane protein(cemA). PMC: Bioactive Cembranoids from the South China Sea Soft Coral Sarcophyton elegans.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us in advance, and we will prioritize its development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Pinus koraiensis (Korean pine)
Target Names
cemA
Target Protein Sequence
MDPIPHSITRTLSRFRTELTSESGSLAIHELEVAEYKASASLRYLACLVGLPWVIPISLR KGLEPWVTNWWNTGKSHQIFDYLQEENALGRFEKIEELFLLERMVEDSSGTHSQDLRIEI HKETIQLVEMYNEDCIQIISHLLTNLIGFAFISAYLILGKNQLAIINSWIQEFFYSLSDT MKAFLILLATDLCIGFHSPHGWELMIDSISENYGFAHNERIISGLVSTFPVILDTILKYW IFRRFNRISPSLVVIYHSMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.