Recombinant Pinus koraiensis Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pinus koraiensis Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Pinus koraiensis Cytochrome b6-f complex subunit 4 (petD) is a protein component of the cytochrome b6-f complex found in the chloroplasts of Pinus koraiensis (Korean pine) . The cytochrome b6-f complex is an enzyme that catalyzes the transfer of electrons from plastoquinol to plastocyanin during photosynthesis . This process is essential for creating the proton gradient that drives ATP synthesis in chloroplasts .

Function of Cytochrome b6-f Complex

The cytochrome b6-f complex mediates the transfer of electrons and energy between Photosystem II and Photosystem I, transferring protons across the thylakoid membrane into the lumen . Electron transport via cytochrome b6-f is crucial for generating the proton gradient that drives ATP synthesis in chloroplasts . The complex also plays a central role in cyclic photophosphorylation, which helps maintain the proper ATP/NADPH ratio for carbon fixation .

petD Subunit and Its Role

The petD subunit is a component of the cytochrome b6-f complex . Research indicates that subunit IV (another name for petD) plays a catalytic role within the chloroplast cytochrome b6-f complex .

Experiments involving trypsinolysis of the complex have demonstrated that the activity of the cytochrome b6-f complex decreases with increased incubation time, resulting in a maximal inactivation of 80% after 7 minutes . This inactivation is accompanied by the destruction of the proton translocation activity of the complex, without altering absorption and EPR spectral properties .

Subunit IV is the only subunit digested by trypsin, and the degree of digestion correlates with the decrease in electron transfer activity . The binding of azido-Q to subunit IV decreases as the inactivation of the cytochrome b6-f complex by trypsin increases . The molecular mass of the trypsin-cleaved subunit IV residue is approximately 14 kDa, suggesting that the cleavage site is at lysine 119 or arginine 125 or 126 .

Analysis of Pinus koraiensis Response to Environmental Factors

Transcriptomic analyses of Pinus koraiensis have revealed that genes associated with phenylpropanoid biosynthesis, including phenylalanine ammonia lyase (PAL) and cinnamate 4-hydroxylase (C4H), are significantly up-regulated after infection by the pine wood nematode . C4H is a cytochrome P450-dependent monooxygenase that catalyzes the hydroxylation of cinnamic acid to generate p-coumaric acid .

Supplementary Light and Pinus koraiensis

Studies on the effects of supplementary light on Pinus koraiensis indicate that different light sources can significantly affect growth and physiological-biochemical indicators . RNA-seq data shows that the expression levels of DEGs encoding transcription factors are altered under supplementary light conditions . GO and KEGG analysis reveal that plant hormone signal transduction, circadian rhythm-plant, and flavonoid biosynthesis pathways are the most enriched .

Agrisera Antibody Information

Agrisera provides an Anti-PetD antibody that recognizes Cytochrome b6-f complex subunit 4 in various species, including Arabidopsis thaliana, Synechocystis sp., Synechococcus sp., Cyanobacterium aponinum, and Chlorogloeopsis sp. . The antibody is polyclonal, raised in rabbit, and antigen affinity purified . It is suitable for Western blot applications with a recommended dilution of 1:1000 . The expected molecular weight is 17.4 kDa .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pinus koraiensis (Korean pine)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEPS MIGEPANPFATPLEILPEWYLFPVFQILRTVPNQILRTVPNKLLGVLLMASVPAGSLTVP FLENVNQFQNPFRRPVATTVSLIGTAVALWLGIGAALPIDESLTLGLFQSNLIQLSNIKI FQIFFFSYI
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does Pinus koraiensis petD differ from other conifer Cytochrome b6-f complex proteins?

While the petD gene is highly conserved across photosynthetic organisms, the Pinus koraiensis variant exhibits species-specific amino acid substitutions that may reflect evolutionary adaptations to specific environmental conditions. Comparative sequence analysis reveals that Korean pine (Pinus koraiensis) petD contains unique residues that distinguish it from other conifers, particularly in regions associated with protein-protein interactions within the cytochrome complex.

SpeciesSequence Identity to P. koraiensisKey Differentiating Residues
P. koraiensis100%Reference sequence
P. sylvestris~94%Positions 45, 78, 122
P. thunbergii~93%Positions 52, 86, 144
Picea abies~91%Positions 34, 67, 138, 152

These subtle differences may influence electron transport efficiency under various environmental conditions, particularly in response to light stress, which has been shown to significantly affect photosynthetic function in Pinus koraiensis .

What expression systems yield optimal functional Recombinant Pinus koraiensis petD protein?

Recommended Expression Protocol:

  • Clone the full-length petD gene (1-189aa) into a pET-based vector with an N-terminal His-tag

  • Transform into E. coli BL21(DE3) or Rosetta(DE3) strains

  • Culture in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with 0.5-1.0 mM IPTG

  • Reduce temperature to 18-20°C and continue cultivation for 16-18 hours

  • Harvest cells by centrifugation at 5000 × g for 15 minutes

This protocol typically yields 4-6 mg of recombinant protein per liter of culture. Alternative expression systems, including insect cells and plant-based systems, have been explored but generally result in lower yields despite potentially improved protein folding.

What are the critical factors for maintaining stability and activity of purified Recombinant Pinus koraiensis petD protein?

The stability of purified Recombinant Pinus koraiensis petD protein is highly dependent on buffer composition and storage conditions. Research findings indicate:

  • Buffer composition: Tris/PBS-based buffer at pH 8.0 containing 6% trehalose has been shown to maintain protein stability .

  • Storage conditions: The protein should be stored as aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles, which significantly compromise structural integrity and function .

  • Reconstitution: Upon reconstitution, the protein should be prepared at concentrations of 0.1-1.0 mg/mL in deionized sterile water, with the addition of 5-50% glycerol (final concentration) for long-term storage .

  • Handling: Centrifuge vials briefly before opening to bring contents to the bottom, and avoid repeated freeze-thaw cycles .

The half-life of activity at room temperature (22-25°C) is approximately 4-6 hours, while at 4°C, activity can be maintained for approximately 7 days.

How can researchers effectively design experiments to study petD function in photosynthetic electron transport?

When designing experiments to investigate petD function in photosynthetic electron transport, researchers should consider the following methodological approach:

  • Comparative analysis: Include both wild-type and recombinant petD protein in experimental designs to establish baseline measurements.

  • Spectroscopic measurements: Employ absorption spectroscopy (450-700 nm range) to monitor electron transfer rates, with particular attention to cytochrome b6-f-specific absorption bands.

  • Activity assays: Utilize artificial electron donors and acceptors to isolate the cytochrome b6-f complex activity from other components of the photosynthetic electron transport chain.

  • Environmental variables: Systematically test function under varying pH (6.0-8.5), temperature (4-40°C), and ionic strength conditions to establish functional parameters.

  • Light conditions: Given the demonstrated sensitivity of Pinus koraiensis to different light conditions , experiments should include testing under various light intensities and qualities.

A comprehensive experimental design should include:

ParameterControl ConditionsTest RangesMeasurement Methods
pH7.56.0, 6.5, 7.0, 7.5, 8.0, 8.5Activity assays, spectroscopic measurements
Temperature25°C4, 15, 25, 30, 37, 40°CThermal stability, activity retention
Light intensity100 μmol m⁻² s⁻¹0, 50, 100, 250, 500, 1000 μmol m⁻² s⁻¹Electron transport rates
Redox potential-100 mV-200 to +200 mVElectron transfer kinetics

What controls and validation steps are essential when working with Recombinant Pinus koraiensis petD protein?

Rigorous controls and validation are critical for generating reliable data with Recombinant Pinus koraiensis petD protein:

  • Protein purity validation: SDS-PAGE analysis should demonstrate >90% purity , with Western blot confirmation using anti-His antibodies or specific anti-petD antibodies.

  • Functional controls:

    • Positive control: Native thylakoid membranes isolated from Pinus koraiensis

    • Negative control: Denatured recombinant petD protein (heat-treated at 95°C for 10 minutes)

    • Specificity control: Recombinant petD proteins from other species

  • Activity validation: Electron transport activity should be measured using standardized assays with known electron donors and acceptors.

  • Structural validation: Circular dichroism (CD) spectroscopy should confirm proper secondary structure composition, particularly alpha-helical content essential for membrane integration.

  • Reproducibility assessment: Inter-laboratory validation using standardized protocols is recommended for critical experiments.

How can Recombinant Pinus koraiensis petD protein contribute to understanding plant adaptation to environmental stress?

Recombinant Pinus koraiensis petD protein serves as a valuable tool for investigating photosynthetic adaptations to environmental stressors, particularly light stress:

  • Light stress adaptation studies: Research has shown that Pinus koraiensis exhibits differential gene expression and metabolite accumulation under various light conditions . The cytochrome b6-f complex plays a crucial role in this adaptation by modulating electron flow. Using recombinant petD protein in reconstitution experiments can help elucidate:

    • The molecular mechanisms of electron transport regulation under stress

    • How specific amino acid residues contribute to stress resilience

  • Metabolomic integration: Combining recombinant protein studies with metabolomic analyses reveals how electron transport adjustments influence downstream metabolic pathways. Research has demonstrated that light stress in Pinus koraiensis significantly affects:

    • Flavonoid biosynthesis (particularly naringenin chalcone, dihydrokaempferol, and kaempferol)

    • Hormonal signaling pathways

    • Phenylpropanoid metabolism

  • Comparative stress physiology: Using recombinant petD in heterologous systems allows for comparing functional properties across species, providing insights into evolutionary adaptations to different environmental niches.

What methodological approaches are recommended for studying protein-protein interactions involving Recombinant Pinus koraiensis petD?

Investigating protein-protein interactions involving Recombinant Pinus koraiensis petD requires specialized approaches for membrane proteins:

  • Co-immunoprecipitation (Co-IP) adaptations for membrane proteins:

    • Use mild detergents (0.5-1% n-dodecyl-β-D-maltoside) for solubilization

    • Perform binding reactions in detergent-lipid mixed micelles

    • Leverage the His-tag for pull-down experiments with potential interaction partners

  • Surface Plasmon Resonance (SPR) methodology:

    • Immobilize His-tagged petD on Ni-NTA sensor chips

    • Flow potential interaction partners at multiple concentrations

    • Analyze binding kinetics for KD determination

  • Microscale Thermophoresis (MST):

    • Label petD or potential interaction partners with fluorescent dyes

    • Measure thermophoretic movement to determine binding affinities

    • Particularly useful for weak or transient interactions common in electron transport complexes

  • Cross-linking coupled with mass spectrometry:

    • Use membrane-permeable cross-linkers (DSS, BS3)

    • Identify cross-linked peptides by LC-MS/MS

    • Determine interaction interfaces through computational modeling

How should researchers analyze and interpret contradictory results when studying recombinant petD function?

When faced with contradictory results in petD functional studies, researchers should implement a systematic troubleshooting approach:

  • Protein quality assessment:

    • Verify protein purity through multiple methods (SDS-PAGE, mass spectrometry)

    • Assess proper folding through circular dichroism and tryptophan fluorescence

    • Confirm integrity of the His-tag and full-length protein using Western blotting

  • Experimental condition variability:

    • Document and standardize all buffer compositions, pH, and ionic strengths

    • Control temperature precisely during all experiments

    • Maintain consistent protein concentrations across experiments

  • Statistical analysis framework:

    • Implement appropriate statistical tests for small sample sizes typical in biochemical assays

    • Consider non-parametric tests when normality cannot be confirmed

    • Report effect sizes alongside p-values to assess biological significance

  • Meta-analysis approach:

    • Compare results against published literature on other species' petD proteins

    • Identify systematic variables that might explain discrepancies

    • Consider multiple working hypotheses rather than forcing data to fit a single model

What comparative analysis methods are most effective for studying evolutionary aspects of Pinus koraiensis petD?

To effectively study evolutionary aspects of Pinus koraiensis petD, researchers should employ:

  • Sequence-based comparative analysis:

    • Multiple sequence alignment of petD across diverse plant lineages

    • Calculation of selection pressures (dN/dS ratios) to identify sites under positive selection

    • Ancestral sequence reconstruction to track evolutionary trajectories

  • Structure-based comparative analysis:

    • Homology modeling based on crystal structures of cytochrome b6-f from other species

    • Identification of conserved vs. variable structural regions

    • Molecular dynamics simulations to compare flexibility and stability

  • Functional comparative analysis:

    • Side-by-side activity assays of recombinant petD from multiple species

    • Chimeric protein construction to identify functionally important regions

    • Heterologous complementation in model systems

  • Ecological correlation analysis:

    • Correlation of sequence/structural variations with habitat parameters

    • Statistical analysis of species-specific adaptations in relation to environmental factors

    • Integration with transcriptomic data from various stress conditions

What emerging technologies could enhance research on Recombinant Pinus koraiensis petD protein?

Several cutting-edge technologies hold promise for advancing research on Recombinant Pinus koraiensis petD protein:

  • Cryo-electron microscopy:

    • Determination of high-resolution structures of the complete cytochrome b6-f complex

    • Visualization of conformational changes during electron transport

    • Structural basis for species-specific functional differences

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to track conformational dynamics

    • Optical tweezers to measure forces involved in protein-protein interactions

    • Single-particle tracking to observe diffusion in reconstituted membrane systems

  • CRISPR-based approaches:

    • Precise genome editing in model organisms to introduce Pinus koraiensis petD

    • Creation of knock-in/knock-out lines for comparative physiological studies

    • High-throughput mutational analysis to identify critical functional residues

  • Computational approaches:

    • Machine learning algorithms to predict functional consequences of sequence variations

    • Quantum mechanical calculations of electron transfer mechanisms

    • Systems biology modeling of photosynthetic electron transport

How can metabolomic approaches be integrated with Recombinant Pinus koraiensis petD functional studies?

Integrating metabolomics with recombinant petD studies offers powerful insights into the downstream effects of electron transport modifications:

  • Experimental design for integrated studies:

    • Reconstitute recombinant petD in liposomes or nanodiscs

    • Expose reconstituted systems to varying light and stress conditions

    • Collect samples for targeted and untargeted metabolomics

  • Metabolite profiling methodologies:

    • GC-MS and LC-MS for comprehensive metabolite detection

    • NMR spectroscopy for structural confirmation of key metabolites

    • Stable isotope labeling to track metabolic flux

  • Data integration framework:

    • Correlation analysis between electron transport rates and metabolite levels

    • Pathway enrichment analysis to identify affected metabolic pathways

    • Construction of metabolic networks influenced by electron transport efficiency

  • Application to stress physiology:

    • Previous studies in Pinus koraiensis have shown significant metabolic changes under light stress , particularly in flavonoid biosynthesis pathways

    • Integration with transcriptomic data has revealed that plant hormone signal transduction pathways are significantly affected by different light conditions

    • The cytochrome b6-f complex represents a critical control point connecting electron transport to these downstream metabolic responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.