Recombinant Pinus koraiensis Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Role

Cytochrome b6 (petB) is a b-type/c-type cytochrome with three heme groups, forming part of the cytochrome b6f complex. This complex facilitates plastoquinol oxidation, proton translocation, and plastocyanin reduction in thylakoid membranes . In Pinus koraiensis, the recombinant petB protein spans 215 amino acids (AA) with a molecular weight of ~24 kDa (apparent MW) . Its structure includes conserved domains critical for heme binding and interactions with subunits like PetD (subunit IV) .

Research Applications and Relevance

This recombinant protein is utilized in:

  • ELISA Assays: For detecting anti-petB antibodies in plant research .

  • Structural Studies: To investigate heme binding and interactions with auxiliary proteins (e.g., PetP in cyanobacteria) .

  • Functional Analysis: Studying the role of the C-terminus in regulating protein kinases (e.g., STT7) and state transitions .

Technical Considerations

  • Stability: Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

  • Reactivity: Polyclonal antibodies (e.g., AS18 4169) target the N-terminal region for cross-species detection .

  • Functional Limitations: The recombinant form lacks post-translational modifications (e.g., heme insertion) critical for native activity, necessitating in vitro reconstitution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference when placing the order, and we will fulfill it to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize developing it accordingly.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Pinus koraiensis (Korean pine)
Target Names
petB
Target Protein Sequence
MGKVYDRFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYLMTEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSVSVGQSTL TRFYSLHTFILPLLTAVFMPMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and regulating state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Pinus koraiensis Cytochrome b6 (petB)?

Pinus koraiensis Cytochrome b6 (petB) is a protein component of the cytochrome b6f complex, essential for photosynthetic electron transport. The full-length protein consists of 215 amino acids with a specific sequence beginning with MGKVYDRFEER and ending with MIRKQGISGPL . The protein's structure features transmembrane domains that anchor it within the thylakoid membrane, with specific regions exposed to either the stromal or lumenal sides of the membrane. Its Uniprot accession number is Q85X07, providing a standardized reference for researchers studying this protein . The protein contains critical binding sites for various cofactors including heme groups that are essential for its electron transport function.

How does the structure of Pinus koraiensis Cytochrome b6 compare to that of other photosynthetic organisms?

Unlike cyanobacterial cytochrome b6 which contains an aminoterminal extension of seven amino acids, the Pinus koraiensis version has a structure more similar to other higher plants . This structural difference reflects evolutionary adaptations across photosynthetic organisms. In cyanobacteria such as Synechocystis sp. PCC 6803, the cytochrome b6 protein undergoes posttranslational modification with the removal of three amino acids from the amino terminus, a process that may differ in pine species . The amino acid sequence of Pinus koraiensis cytochrome b6 reveals conservation of functional domains essential for electron transport while exhibiting species-specific variations that may affect interaction with other protein components of the photosynthetic apparatus.

What is the functional significance of the C-terminus in cytochrome b6 proteins like that found in Pinus koraiensis?

The C-terminus of cytochrome b6 plays a critical role in the regulation of photosynthetic state transitions, which distribute light energy between photosystem I (PSI) and photosystem II (PSII) . Research indicates that the terminal residue L215 of the cytochrome b6 subunit is particularly important, as modifications to this region can affect both protein complex assembly and function . In Chlamydomonas reinhardtii, truncation or elongation of the cytochrome b6 C-terminus disrupts salt bridge formation between the cytochrome b6 (PetB) and Subunit IV (PetD), which is essential for proper assembly of the complex . While these findings are from a different photosynthetic organism, they suggest that the C-terminal region of Pinus koraiensis cytochrome b6 likely serves similar crucial functions in complex stability and regulatory signaling in the photosynthetic electron transport chain.

What are the optimal storage conditions for Recombinant Pinus koraiensis Cytochrome b6 for experimental use?

For optimal maintenance of protein integrity, Recombinant Pinus koraiensis Cytochrome b6 should be stored in a Tris-based buffer with 50% glycerol, which has been specifically optimized for this protein . Standard storage should be at -20°C, while extended storage is recommended at either -20°C or -80°C to minimize protein degradation . It is crucial to avoid repeated freeze-thaw cycles as these can compromise protein structure and function. For working experiments that span up to one week, aliquots can be maintained at 4°C . Creating multiple small-volume working aliquots rather than repeatedly accessing a single stock solution can significantly extend the usable lifetime of the protein and ensure consistent experimental results across multiple studies.

What methodological approaches can be used to study cytochrome b6 protein-protein interactions in photosynthetic complexes?

Several complementary methodological approaches can effectively investigate protein-protein interactions involving cytochrome b6. Bimolecular fluorescence complementation (BiFC) assays have been successfully used to confirm protein interactions in similar photosynthetic research contexts . DNA pull-down assays combined with mass spectrometry analysis can identify protein binding partners, as demonstrated in studies of related proteins in Pinus massoniana . Co-immunoprecipitation (Co-IP) is another valuable technique for identifying direct protein interactions in physiological conditions. For structural studies of the complete cytochrome b6f complex, techniques such as X-ray crystallography or cryo-electron microscopy could reveal detailed interaction interfaces. Research examining salt bridge formation between cytochrome b6 (PetB) and Subunit IV (PetD) suggests that mutagenesis studies targeting specific amino acid residues can provide insights into the structural requirements for complex assembly and stability .

How can site-directed mutagenesis be applied to study the functional domains of cytochrome b6 in pine species?

Site-directed mutagenesis represents a powerful approach for investigating functional domains within cytochrome b6. Based on findings from Chlamydomonas reinhardtii research, modifications to the C-terminal region through truncation (removing L215) or elongation (adding G216) can provide insights into the role of this region in complex assembly and function . Similarly, targeted replacement of specific amino acids, such as the arginine that interacts with heme groups (comparable to R207K mutation in other systems), can elucidate the importance of cofactor binding sites . When designing such experiments for Pinus koraiensis cytochrome b6, researchers should consider using chloroplast transformation techniques appropriate for gymnosperms. Analysis of mutant phenotypes should examine multiple parameters including complex assembly, electron transport rates, state transitions, and plant growth under various light conditions to comprehensively assess functional impacts of the mutations.

What is known about the genetic organization of the petB gene in Pinus koraiensis?

The petB gene in Pinus koraiensis encodes the cytochrome b6 protein with an expression region spanning positions 1-215 of the amino acid sequence . While complete information specific to Pinus koraiensis is limited in the provided search results, comparisons with other photosynthetic organisms provide valuable insights. In contrast to some higher plants where petB contains introns, the gene structure in pine species likely differs . The full cytochrome b6 protein in Pinus koraiensis contains 215 amino acids, suggesting a coding sequence of approximately 645 nucleotides (excluding any untranslated regions) . The gene is part of the chloroplast genome, reflecting its essential role in photosynthesis. Understanding the genetic organization is crucial for designing expression systems that accurately reflect the native protein's structure and function.

How does the expression of petB compare between Pinus koraiensis and other photosynthetic organisms?

Expression patterns of petB likely vary between Pinus koraiensis and other photosynthetic organisms due to evolutionary adaptations. In cyanobacteria like Synechocystis sp. PCC 6803, the petB gene encodes a protein with an aminoterminal extension not found in higher plants, indicating fundamental differences in gene structure and expression . Unlike some higher plants, cyanobacterial petB genes do not contain introns after the first amino acids, which affects processing of the transcript . The posttranslational modifications also differ, with cyanobacteria showing removal of three amino acids from the amino terminus . While specific expression data for Pinus koraiensis petB is not detailed in the search results, the conservation of the protein sequence suggests that expression mechanisms are likely adapted to the conifer's photosynthetic requirements, possibly with unique regulatory elements controlling expression in response to environmental conditions such as light intensity, temperature, and seasonal changes relevant to this pine species.

What techniques are most effective for analyzing petB gene expression in conifer species like Pinus koraiensis?

For effective analysis of petB gene expression in conifers, several complementary techniques should be employed. Quantitative PCR (qPCR) with primers specific to the Pinus koraiensis petB sequence can quantify transcript levels under various experimental conditions. RNA-Seq approaches provide a broader view of transcriptional changes, placing petB expression in the context of global gene expression patterns. For protein-level analysis, western blotting with antibodies specific to cytochrome b6 can confirm translation of the transcript and allow quantification of protein abundance. Proteomics approaches using mass spectrometry can identify posttranslational modifications that may regulate protein function, particularly important given the known modifications in other species . In situ hybridization techniques can localize expression within specific tissue types, which is valuable for understanding developmental regulation of photosynthetic complexes. When designing such studies, researchers should consider the unique challenges of working with conifer tissues, including the presence of inhibitory compounds that can interfere with nucleic acid isolation and enzymatic reactions.

What proteins interact with cytochrome b6 in the formation of functional photosynthetic complexes?

Cytochrome b6 forms critical interactions with multiple proteins to create the functional cytochrome b6f complex. Most notably, cytochrome b6 (PetB) forms essential interactions with Subunit IV (PetD) through salt bridges that are crucial for complex assembly and stability . Research in photosynthetic organisms indicates that the cytochrome b6f complex interfaces with other major photosynthetic components, including photosystem I, photosystem II, and the state transitions 7 (STT7) protein kinase . While not specific to Pinus koraiensis, studies of related systems suggest potential interactions with ATP synthase components, as ATP synthase CF1 α and β subunits have been identified in interactome studies of photosynthetic proteins . The full interactome of Pinus koraiensis cytochrome b6 would include both structural partners within the cytochrome b6f complex and functional interaction partners involved in electron transport and regulatory processes.

How do structural modifications to cytochrome b6 affect its interaction with other components of the photosynthetic apparatus?

Structural modifications to cytochrome b6 can profoundly affect its interactions with other components of the photosynthetic apparatus. Research demonstrates that even minor modifications to the C-terminus, such as truncation (removing L215) or elongation (adding G216), can disrupt the formation of salt bridges between cytochrome b6 (PetB) and Subunit IV (PetD), leading to complex instability . When these modifications occur, the altered complex becomes susceptible to degradation by proteases such as FTSH, indicating quality control mechanisms that eliminate improperly assembled complexes . Furthermore, modifications that affect heme binding, such as replacement of the arginine interacting with heme ci propionate (comparable to the R207K mutation), can impact electron transport capabilities . These structural changes not only affect complex assembly but also disrupt downstream signaling cascades, as evidenced by the blockage of the phosphorylation cascade in modified complexes . The intricate relationship between structure and function underscores the precision required in the assembly of these photosynthetic complexes.

What methodological approaches can reveal the dynamics of cytochrome b6f complex assembly in Pinus koraiensis?

Investigating cytochrome b6f complex assembly dynamics in Pinus koraiensis requires multiple methodological approaches. Time-course studies using pulse-chase labeling with radioactive or stable isotopes can track the synthesis, assembly, and turnover of complex components. Blue native polyacrylamide gel electrophoresis (BN-PAGE) combined with western blotting can separate and identify assembly intermediates and subcomplexes. Cryo-electron microscopy or crystallography could provide structural insights into the fully assembled complex, though these techniques present challenges with membrane proteins. Fluorescence resonance energy transfer (FRET) using tagged components can monitor protein-protein interactions in real-time within living chloroplasts. Genetic approaches, including the creation of mutants with modified cytochrome b6, can reveal the impact of specific protein regions on assembly, similar to studies in other photosynthetic organisms that demonstrated the importance of the C-terminus and salt bridge formation . Complementing these approaches with computational modeling based on known structures from other species could predict critical interaction interfaces specific to the Pinus koraiensis complex.

How does cytochrome b6 contribute to the regulation of state transitions in photosynthesis?

Cytochrome b6 plays a crucial role in regulating state transitions, which optimize photosynthetic efficiency by balancing energy distribution between photosystem I and photosystem II. The stromal side of the cytochrome b6f complex, particularly the C-terminus of the cytochrome b6 subunit, is involved in the activation of the state transitions 7 (STT7) protein kinase . When the plastoquinone pool becomes reduced under changing light conditions, the cytochrome b6f complex facilitates the activation of STT7, which then phosphorylates light-harvesting complex II (LHCII) proteins . This phosphorylation triggers the migration of LHCII between photosystems, redistributing excitation energy to optimize photosynthetic efficiency. Modification studies demonstrate that alterations to the C-terminus of cytochrome b6 can block this phosphorylation cascade, preventing proper state transitions . These findings suggest that in Pinus koraiensis, the cytochrome b6 protein likely serves a similar critical function in the regulatory mechanisms that allow photosynthetic adaptation to changing light environments.

What is the significance of heme binding in cytochrome b6 function and how can this be studied?

Heme binding is essential for the electron transport function of cytochrome b6, with specific binding sites critical for proper protein folding and activity. Research indicates that cytochrome b6 contains multiple heme groups, including heme ci, which is particularly important for function . The interaction between specific amino acid residues, such as arginine (comparable to R207 in some species), and heme propionates creates structural stability and facilitates efficient electron transfer . When these interactions are disrupted through mutations, both complex assembly and electron transport function can be compromised. To study heme binding in Pinus koraiensis cytochrome b6, researchers can employ spectroscopic techniques such as absorption spectroscopy and electron paramagnetic resonance (EPR) to characterize the heme environment. Site-directed mutagenesis targeting predicted heme-interacting residues, followed by functional assays measuring electron transport rates, can reveal the contribution of specific amino acids to heme binding and function. Computational modeling based on the amino acid sequence provided in the search results could also predict heme-binding sites specific to the Pinus koraiensis protein.

TechniqueApplication to Heme Binding StudiesAdvantagesLimitations
Absorption SpectroscopyCharacterizes heme environment and redox stateNon-destructive, can be performed in real-timeLimited structural information
Electron Paramagnetic ResonanceProvides detailed information about unpaired electrons in hemeHighly sensitive to electronic environmentRequires specialized equipment
Site-Directed MutagenesisIdentifies critical residues for heme bindingDirect causal relationship between structure and functionTime-consuming, requires genetic transformation system
X-ray CrystallographyReveals precise spatial arrangement of heme within proteinAtomic-level structural detailDifficult with membrane proteins, static snapshots only
Molecular Dynamics SimulationPredicts dynamic interactions between heme and proteinCan model conditions difficult to study experimentallyComputational models require validation

How do environmental factors affect the function and stability of cytochrome b6 in Pinus koraiensis?

Environmental factors significantly influence the function and stability of cytochrome b6 in Pinus koraiensis, reflecting the adaptation of this conifer to its ecological niche. Temperature fluctuations likely affect protein stability and electron transport rates, with the recommended storage conditions (-20°C for standard storage, 4°C for working aliquots) suggesting temperature sensitivity. Light intensity and quality drive the redox state of the plastoquinone pool, directly affecting cytochrome b6f complex activity and the regulation of state transitions . Seasonal variations, particularly relevant for conifers in temperate regions, may induce changes in complex abundance and composition to optimize photosynthesis under different growth conditions. Stress conditions such as drought, which commonly affects forest ecosystems, could alter membrane integrity and impact the functional environment of the cytochrome b6f complex. To study these environmental effects, researchers should design experiments that monitor cytochrome b6 abundance, complex assembly, and electron transport rates under controlled environmental conditions mimicking those experienced by Pinus koraiensis in its native habitat. Such studies would provide valuable insights into the adaptation mechanisms of conifer photosynthesis across variable environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.