Recombinant Pinus koraiensis Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Pinus koraiensis (Korean pine)
Target Names
ycf4
Target Protein Sequence
MNRRSKWLWIEPITGSRKRSNFFWACILFLGSLGFFLVGISSYFGENLIPLLSSQQILFV PQGIVMCFYGIAGLFISSYLWCTILFNVGSGYNKFDKKKGIVCLFRWGFPGINRRIFSRF LMKDIQMIKTEIQEGISPRRVLYMEIKGRQDIPLTRTGDNVNLREIEQKAAESARFLRVS IEGF
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the ycf4 gene and its function in Pinus koraiensis?

The ycf4 gene in Pinus koraiensis encodes the Ycf4 protein, which plays an essential role in the assembly of photosystem I (PSI) complexes in the chloroplast. This protein serves as a scaffold for the assembly of newly synthesized PSI components, facilitating their proper arrangement and integration into functional PSI units. In organisms like Chlamydomonas reinhardtii, Ycf4 is known to be part of a large complex (>1500 kD) that contains PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Similar mechanisms are expected in P. koraiensis, though specific protein interactions may differ due to evolutionary divergence.

The ycf4 gene is located in the chloroplast genome, typically within a polycistronic transcriptional unit, and its absence can lead to significant reduction or complete loss of PSI accumulation, depending on the species . In P. koraiensis, like other photosynthetic organisms, Ycf4 is crucial for maintaining photosynthetic efficiency and, consequently, plant fitness.

How does the expression of ycf4 vary during different developmental stages of P. koraiensis?

The expression of ycf4 in P. koraiensis follows developmental patterns consistent with its role in photosynthetic machinery assembly. Expression is highest during leaf development and chloroplast biogenesis, when photosynthetic complexes are being actively assembled. In mature tissues, expression levels typically decrease but maintain steady-state levels necessary for ongoing PSI maintenance and repair.

Under stress conditions, such as those induced by pathogen infection, expression patterns may change as part of the general stress response. For instance, in P. koraiensis under pine wood nematode infection, many stress-response proteins show altered expression patterns . While ycf4 wasn't specifically identified in this response, photosynthetic proteins often undergo regulatory changes during biotic stress.

Research methods to study ycf4 expression include:

  • Quantitative RT-PCR with gene-specific primers

  • RNA-Seq analysis comparing different developmental stages

  • Immunoblotting using antibodies specific to the Ycf4 protein

  • Reporter gene assays using ycf4 promoter constructs

How has the ycf4 gene evolved in P. koraiensis compared to other plant species?

The evolution of ycf4 shows interesting patterns across plant lineages. In legumes of the inverted repeat lacking clade (IRLC), ycf4 exhibits significant variability, with evidence of positive selection . This suggests that the gene has undergone adaptive evolution in response to specific environmental pressures in these species.

Methodology for evolutionary analysis includes:

  • Sequence alignment of ycf4 across diverse plant taxa

  • Calculation of dN/dS ratios to detect selection pressure

  • Phylogenetic tree construction to map evolutionary relationships

  • Structural modeling to identify functionally important domains

What comparative genomic approaches are most effective for studying ycf4 evolution across plant species?

For effective comparative genomic analysis of ycf4 evolution, researchers should employ a multi-faceted approach:

  • Whole Plastome Sequencing: Complete chloroplast genome sequencing provides context for ycf4 evolution within genome-wide patterns of selection and rearrangement. This is particularly important given that the "genome organization and gene content of plastome (plastid genome) are highly conserved among most flowering plant species," with notable exceptions in families like Fabaceae .

  • Targeted Gene Capture: Focused sequencing of ycf4 and surrounding regions across a diverse array of species allows for fine-scale evolutionary analysis.

  • Positive Selection Analysis: Software tools like PAML, HyPhy, or MEME can detect site-specific and branch-specific selection patterns. This approach revealed that "ycf4 gene has undergone positive selection" in certain legume lineages .

  • Synteny Analysis: Examining the conservation of gene order around ycf4 can provide insights into structural evolution of the plastome.

  • Protein Structure Prediction: Comparing predicted protein structures helps identify conservation patterns in functional domains versus variable regions.

A comprehensive dataset should include representatives from major plant lineages, with particular attention to closely related species, to detect both broad evolutionary patterns and recent adaptations.

What are the best methods for isolating and purifying recombinant Ycf4 from P. koraiensis?

Isolation and purification of recombinant Ycf4 from P. koraiensis requires specialized techniques due to the membrane-associated nature of this protein. The following method has proven effective:

Expression System Selection:

  • E. coli BL21(DE3) with codon optimization for conifer genes

  • Specialized strains like C41(DE3) designed for membrane protein expression

  • Baculovirus-insect cell system for complex eukaryotic proteins

Purification Protocol:

  • Tandem affinity purification (TAP) tagging approach, similar to that used for Chlamydomonas Ycf4

  • Cell lysis under gentle conditions (20 mM HEPES-KOH, pH 7.5, 10 mM MgCl₂, 100 mM NaCl)

  • Membrane solubilization using mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

  • Two-step affinity chromatography using the TAP-tag system

  • Optional size exclusion chromatography for higher purity

Critical Parameters:

  • Maintain low temperature (4°C) throughout purification

  • Include protease inhibitors to prevent degradation

  • Consider adding glycerol (10-15%) for protein stability

  • Validate protein identity by mass spectrometry and immunoblotting

This approach has been successfully applied to chloroplast proteins in model organisms, with the TAP-tag method specifically allowing "high purification" through "two-step affinity column chromatography" .

How can researchers effectively characterize protein complexes containing Ycf4 in P. koraiensis?

Characterization of Ycf4-containing complexes in P. koraiensis requires multiple complementary approaches to understand complex composition, structure, and function:

Complex Isolation Methods:

  • Blue Native-PAGE for separation of intact membrane protein complexes

  • Sucrose gradient ultracentrifugation followed by ion exchange chromatography, which has been effective in showing "intimate and exclusive association" of proteins in complexes

  • Size exclusion chromatography for molecular weight determination

  • Co-immunoprecipitation with Ycf4-specific antibodies

Compositional Analysis:

  • Mass spectrometry (LC-MS/MS) for protein identification, as was used to identify components of the Ycf4 complex in Chlamydomonas

  • Immunoblotting with antibodies against expected interaction partners

  • Pulse-chase protein labeling to identify newly synthesized proteins incorporated into the complex

Structural Characterization:

Functional Analysis:

  • In vitro reconstitution assays to test assembly function

  • Site-directed mutagenesis of key residues to disrupt specific interactions

  • Chlorophyll fluorescence measurements to assess PSI assembly and function

These methods have successfully revealed that Ycf4-containing complexes can measure "285 × 185 Å" and may represent "several large oligomeric states" .

What role might Ycf4 play in the P. koraiensis defense response against pathogens?

While Ycf4's primary function relates to photosystem I assembly, emerging evidence suggests photosynthetic proteins may have secondary roles in plant defense responses. In P. koraiensis infected with pine wood nematode (B. xylophilus), complex transcriptomic, metabonomic, and proteomic changes occur, particularly in pathways involved in secondary metabolism .

Potential Defense-Related Functions of Ycf4:

  • Redox Signaling Hub: PSI is a major site of reactive oxygen species production. Ycf4, through its role in PSI assembly, may indirectly influence redox signaling pathways activated during pathogen attack.

  • Metabolic Reprogramming: During infection, P. koraiensis undergoes significant metabolic changes, including upregulation of "terpenoid-, phenylpropanoid-, flavonoid- and carbohydrate-related events" . Photosynthetic adjustments involving Ycf4 may contribute to these metabolic shifts.

  • Energy Allocation: By modulating PSI assembly efficiency, Ycf4 could influence energy allocation between photosynthesis and defense responses.

Research Methods to Investigate This Role:

  • Gene expression analysis of ycf4 during pathogen infection time courses

  • Immunoprecipitation followed by mass spectrometry to identify defense-related proteins interacting with Ycf4 during infection

  • Comparative studies between wild-type and ycf4-modified plants challenged with pathogens

  • Metabolomic analysis to correlate changes in Ycf4 activity with defense compound production

In P. koraiensis infected with B. xylophilus, proteins like "plant receptor-like serine/threonine kinases" and "pectin methylation modulators" were significantly upregulated , suggesting complex signaling networks activate during infection that may intersect with chloroplast functions.

What are common challenges in expressing recombinant P. koraiensis Ycf4 and how can they be addressed?

Expression of recombinant P. koraiensis Ycf4 presents several challenges due to its membrane protein nature and plant-specific features. Here are common issues and solutions:

ChallengeCauseSolution
Low expression levelsCodon bias in heterologous systemsUse codon-optimized synthetic gene; select appropriate host strain (Rosetta, CodonPlus)
Protein insolubilityHydrophobic membrane domainsExpress as fusion with solubility tags (MBP, SUMO); use specialized membrane protein expression strains
Protein misfoldingIncorrect disulfide bond formationExpress in systems with oxidizing cytoplasm; co-express with chaperones
Toxicity to expression hostInterference with host photosynthesisUse tightly controlled inducible promoters; lower induction temperature (16-20°C)
DegradationProteolytic sensitivityUse protease-deficient strains; optimize extraction buffer with protease inhibitors
Lack of cofactor incorporationMissing chloroplast-specific factorsConsider chloroplast protein expression systems or partial reconstitution approaches

For membrane proteins like Ycf4, adopting strategies from successful studies is critical. The TAP-tag approach used for Chlamydomonas Ycf4 provides a useful template, though modifications may be needed for conifer proteins . Importantly, fusion tags should be tested at both N- and C-termini, as C-terminal tagging was successful in the Chlamydomonas study where researchers confirmed that "the function and structure of Ycf4 are not significantly affected by the fusion of the TAP-tag at the C terminus" .

How can researchers validate the functional activity of recombinant P. koraiensis Ycf4?

Validating the functional activity of recombinant P. koraiensis Ycf4 requires assays that test its ability to participate in PSI assembly. The following approaches provide comprehensive validation:

In Vitro Assembly Assays:

  • Reconstitution experiments combining purified Ycf4 with PSI subunits and monitoring complex formation

  • Pull-down assays to verify interactions with PSI components (PsaA, PsaB, etc.)

  • Size exclusion chromatography to detect formation of high molecular weight complexes

Complementation Studies:

  • Expression of recombinant P. koraiensis Ycf4 in ycf4-deficient model organisms (Chlamydomonas, cyanobacteria)

  • Assessment of PSI accumulation and function in complemented lines

  • Growth phenotype analysis under photosynthesis-dependent conditions

Biophysical Characterization:

  • Circular dichroism to verify proper protein folding

  • Fluorescence quenching assays to measure binding to PSI components

  • Microscale thermophoresis for quantitative binding affinity measurements

Functional Readouts:

  • Chlorophyll fluorescence measurements (F0, Fm, Fv/Fm) to assess PSI functionality

  • P700 oxidation kinetics specific to PSI activity

  • Oxygen evolution measurements under PSI-specific illumination conditions

Validation should include controls such as inactive Ycf4 mutants and comparison to native Ycf4 activity. In studies of Chlamydomonas Ycf4, researchers confirmed function through "fluorescence induction kinetics of dark-adapted cells" and growth tests under various light conditions .

What are promising research avenues for understanding P. koraiensis Ycf4 in the context of climate change?

Climate change presents unique stresses to conifer species like P. koraiensis, making the study of photosynthetic assembly factors increasingly relevant. Promising research directions include:

  • Thermal Tolerance Mechanisms: Investigate how Ycf4 function and PSI assembly efficiency change across temperature gradients relevant to predicted climate scenarios. This could reveal adaptive mechanisms in P. koraiensis compared to less thermotolerant species.

  • Drought Response Interactions: Explore how water limitation affects Ycf4-mediated assembly pathways and whether Ycf4 modifications could enhance photosynthetic resilience during drought episodes.

  • CO₂ Responsiveness: Examine how elevated CO₂ levels influence Ycf4 expression and function, potentially revealing adaptation mechanisms for optimizing carbon fixation under changing atmospheric conditions.

  • Cross-Talk with Stress Pathways: Investigate interactions between Ycf4-related processes and stress response pathways, including those involving terpenoids and flavonoids, which are "required for P. koraiensis early defence against B. xylophilus infection" .

  • Comparative Ecophysiology: Compare Ycf4 sequence, expression patterns, and function across P. koraiensis populations from different climate zones to identify natural adaptations to varying environmental conditions.

These research directions should utilize combined approaches of field studies, controlled environment experiments, and molecular analyses to understand both mechanism and ecological relevance.

How might CRISPR/Cas9 or other gene editing techniques be applied to study ycf4 function in P. koraiensis?

Chloroplast Transformation Strategies:

  • Biolistic transformation of chloroplasts using species-optimized promoters and regulatory elements

  • Development of P. koraiensis tissue culture systems amenable to chloroplast transformation

  • Use of polyethylene glycol-mediated transformation of protoplasts with subsequent regeneration

CRISPR Applications for Chloroplast Genes:

  • Expression of Cas9 with chloroplast targeting sequences and ycf4-specific guide RNAs

  • Transplastomic approach where Cas9 is expressed from the chloroplast genome itself

  • Base editing approaches that may have higher efficiency in organellar genomes

Alternative Approaches When Direct Editing Is Challenging:

  • Virus-induced gene silencing (VIGS) adapted for conifers to knockdown ycf4 expression

  • Expression of dominant-negative Ycf4 variants to disrupt native protein function

  • Heterologous expression systems using ycf4-deficient mutants of model organisms complemented with P. koraiensis ycf4 variants

Phenotypic Analysis of Modified Plants:

  • Photosynthetic parameter measurements (chlorophyll fluorescence, P700 oxidation)

  • Growth and development assessment under various environmental conditions

  • Proteomics to analyze effects on PSI assembly and thylakoid protein composition

  • Stress response characterization, particularly in light of P. koraiensis complex defense mechanisms

While technically challenging, these approaches would provide unprecedented insights into ycf4 function in conifers and potentially reveal novel aspects of PSI assembly unique to gymnosperms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.