Recombinant Pinus koraiensis Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Biological Role of CP47 in Photosystem II

CP47 is a core chlorophyll-binding protein in PSII, acting as an inner antenna system that channels light energy to the reaction center . It binds approximately 14–16 chlorophyll a molecules and β-carotene, stabilizing the oxygen-evolving complex and facilitating electron transport . The psbB gene encodes this apoprotein, which is essential for PSII assembly and function .

Production Details

  • Host System: E. coli

  • Tag: N-terminal His-tag (type determined during production)

  • Purity: >90% (SDS-PAGE)

  • Form: Lyophilized powder in Tris-based buffer with 50% glycerol

Applications in Research

  • Photosynthesis Studies: Used to investigate PSII assembly, chlorophyll-protein interactions, and energy transfer mechanisms .

  • Antibody Production: Serves as an antigen for generating antibodies targeting CP47 .

  • Structural Biology: Facilitates X-ray crystallography and cryo-EM studies due to high purity and stability .

Comparative Analysis of Recombinant CP47 Variants

SpeciesPinus koraiensis Pinus thunbergii Draba nemorosa
UniProt IDQ85X12P41624A4QL45
Chlorophyll Binding14–16 moleculesSimilar topology Structural homology
Expression HostE. coliE. coliE. coli
TagHis (variable)N-terminal HisN-terminal His

Research Findings and Limitations

  • Assembly Role: CP47 forms preassembled complexes with PsbH, PsbL, and PsbT before PSII integration .

  • Spectroscopic Properties: Recombinant CP47 exhibits a blue-shifted emission maximum compared to native proteins, suggesting slight structural differences .

  • Limitations: Requires detergent solubilization for in vitro studies, which may alter native conformation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice packaging, please inform us in advance. Additional fees may apply for this service.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution, storing at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by numerous factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months when stored at -20°C/-80°C. For lyophilized forms, the shelf life extends to 12 months under the same storage conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles to maintain product integrity.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us. We will prioritize the development of your preferred tag type.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Pinus koraiensis (Korean pine)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMTLYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGIKDSWSGWNITGETVINPGIWSYEGVAGAHIMFSGLMFLAAIWHWVYWDL EIFYDERTGKLCLDLPKVFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKIQP VDPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYVGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPVELFGPTRYQWDQGYFQQEIDRRVRAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKEGNELFVRRMP TFFETFPVVLVDKEGIVKADVPFRRAESKYSVEQVGVTVEFYGGGLDRVSFGDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFSGHIWHGARTLFRDVFA GIDPDLDSRIEFGAFQKLGDPTTKRQVV
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a crucial component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical reactions within PSII. PSII is a light-driven water:plastoquinone oxidoreductase, using light energy to extract electrons from H2O. This process generates O2 and a proton gradient, which is subsequently utilized for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 chlorophyll apoprotein and what role does it play in photosystem II of Pinus koraiensis?

CP47 (also known as psbB) is an integral antenna protein of Photosystem II that plays a crucial role in light-harvesting and excitation energy transfer to the reaction center. In Pinus koraiensis, as in other photosynthetic organisms, CP47 contains multiple chlorophyll molecules that capture light energy and transfer it efficiently to the PSII reaction center. This protein is essential for initiating the electron transfer cascade that drives oxygenic photosynthesis . The CP47 protein specifically acts as a bridge between peripheral light-harvesting complexes and the reaction center, making it crucial for photosynthetic efficiency under various light conditions .

What genomic and transcriptomic characteristics of the psbB gene have been identified in Pinus koraiensis?

Transcriptomic analyses of Pinus koraiensis under different light conditions have revealed that genes involved in photosynthesis, including those related to photosystem II components like psbB, show differential expression patterns under light stress . The psbB gene in P. koraiensis, like in other plants, is typically chloroplast-encoded and regulated in response to environmental factors, particularly light intensity and quality.

Comparative studies with other Pinus species suggest that P. koraiensis maintains relatively high nucleotide diversity (comparable to P. pumila with πsil values around 0.00652) , which might extend to its photosynthetic genes, potentially conferring adaptability to various environmental conditions.

What expression systems are most effective for producing recombinant Pinus koraiensis CP47 chlorophyll apoprotein?

Based on procedures established for similar proteins, E. coli expression systems typically provide an effective platform for recombinant production of photosystem proteins like CP47. For example, similar photosynthetic proteins have been successfully expressed in E. coli with N-terminal His tags to facilitate purification . When expressing CP47 from P. koraiensis, researchers should consider the following methodology:

  • Gene synthesis or amplification of the psbB gene from P. koraiensis

  • Cloning into an appropriate expression vector with a His-tag or other affinity tag

  • Transformation into an E. coli expression strain optimized for membrane proteins

  • Induction under controlled temperature and media conditions

  • Extraction using appropriate detergents to solubilize the membrane protein

  • Purification via affinity chromatography utilizing the added tag

Alternatively, insect cell or green algae expression systems might offer advantages for proper folding of this complex membrane protein with multiple chlorophyll binding sites.

What are the critical considerations for maintaining structural integrity when expressing recombinant P. koraiensis CP47 protein?

Producing functional recombinant CP47 presents several challenges due to its complex structure and chlorophyll-binding properties. Key considerations include:

  • Chlorophyll incorporation: Unlike the native environment, expression systems like E. coli do not naturally produce chlorophyll. Researchers must develop strategies to either incorporate chlorophyll during protein refolding or express the apoprotein form without chlorophylls.

  • Membrane integration: CP47 is a membrane protein with multiple transmembrane domains. Expression protocols should include optimized detergents for solubilization and purification that maintain protein structure.

  • Buffer optimization: Based on protocols for similar proteins, researchers should consider Tris/PBS-based buffers with stabilizing agents such as 6% trehalose at pH 8.0 for storage .

  • Storage conditions: Lyophilization may be appropriate for long-term storage, with reconstitution in deionized water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol is recommended for samples stored at -20°C/-80°C to prevent freeze-thaw damage .

  • Protein verification: SDS-PAGE analysis should be used to confirm protein integrity, with expected purity greater than 90% .

How do the excitation energies of chlorophylls in CP47 affect energy transfer efficiency, and how can these be measured in recombinant P. koraiensis protein?

The excitation energies of chlorophylls in CP47 critically determine the pathways and efficiency of energy transfer within the photosystem II complex. Recent quantum mechanics/molecular mechanics (QM/MM) approaches using time-dependent density functional theory have proven valuable for computing excitation energies of all chlorophylls in CP47 .

For recombinant P. koraiensis CP47, researchers could employ the following methodological approach:

Research on other photosystem II complexes has identified that certain chlorophylls (B3 followed by B1 in the case of cyanobacterial CP47) exhibit red-shifted excitation energies that significantly impact the energy transfer pathways .

What structural features of Pinus koraiensis CP47 contribute to its stability under varying light conditions?

P. koraiensis has evolved mechanisms to maintain photosynthetic efficiency under varying light conditions, including structural features of CP47 that likely contribute to its stability. Based on transcriptomic and metabolic analyses, the following factors likely influence CP47 stability:

  • Protein-pigment interactions: Specific amino acid residues surrounding the chlorophyll molecules stabilize the chlorophylls and fine-tune their excitation energies .

  • Response to light stress: Under light stress conditions, P. koraiensis shows differential regulation of genes involved in photosynthesis, potentially including those affecting CP47 stability and function .

  • Metabolic adaptations: P. koraiensis accumulates specific flavonoids (including naringenin chalcone, dihydrokaempferol, and kaempferol) under light stress, which may play photoprotective roles for photosystem components including CP47 .

  • Transcription factor involvement: MYB-related, AP2-ERF, and bHLH transcription factors show increased expression during light stress in P. koraiensis, potentially regulating genes involved in photosystem stability .

  • Hormonal regulation: Phytohormone signaling pathways are implicated in the response of P. koraiensis to light stress, which may indirectly affect CP47 stability through adaptive responses .

What is known about the electrostatic effects of the protein environment on chlorophyll site energies in CP47, and how might this differ in Pinus koraiensis?

The protein environment surrounding chlorophyll molecules in CP47 exerts significant electrostatic effects that influence the site energies of these pigments. Recent high-level quantum chemical analyses of CP47 have demonstrated that:

  • The protein matrix creates an electrostatic field that can shift the excitation energies of individual chlorophylls by several nanometers .

  • This electrostatic effect creates a unique energy landscape that directs the flow of excitation energy toward the reaction center .

  • In cyanobacterial CP47, chlorophylls B3 and B1 have been identified as the most red-shifted, contrary to some previous literature hypotheses .

For P. koraiensis CP47, specific amino acid variations in the protein matrix might create a unique electrostatic environment compared to other species. These species-specific adaptations could be particularly important for P. koraiensis' survival in its native habitat, potentially optimizing excitation energy transfer under the specific light conditions of northeastern China, Russia, and Korean Peninsula forests .

What protocols are most effective for studying the interaction between recombinant P. koraiensis CP47 and other photosystem II components?

To study interactions between recombinant P. koraiensis CP47 and other photosystem II components, researchers could employ the following methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant CP47 or against native photosystem II components to pull down protein complexes and identify interacting partners.

  • Surface Plasmon Resonance (SPR): Immobilizing recombinant CP47 on a sensor chip and flowing other PSII components over it to measure binding kinetics and affinities.

  • Förster Resonance Energy Transfer (FRET): Labeling CP47 and potential interaction partners with fluorescent dyes to detect proximity and interaction in vitro or in reconstituted membrane systems.

  • Reconstitution experiments: Incorporating recombinant CP47 into liposomes along with other PSII components to study functional assembly and energy transfer.

  • Cross-linking coupled with mass spectrometry: To identify specific amino acid residues involved in protein-protein interactions between CP47 and other PSII components.

These approaches would provide complementary information about both structural and functional aspects of CP47 interactions within the photosystem II complex.

How can researchers accurately assess the impact of site-directed mutations on CP47 function in recombinant systems?

Assessing the impact of site-directed mutations on CP47 function requires a multi-faceted approach:

  • Spectroscopic analysis: Compare absorption and fluorescence spectra of wild-type and mutant proteins to identify changes in chlorophyll binding or excitation energy properties.

  • Thermal stability assays: Measure protein stability using differential scanning calorimetry or fluorescence-based thermal shift assays to determine if mutations affect protein folding or stability.

  • Energy transfer kinetics: Use time-resolved spectroscopy to measure changes in energy transfer rates between chlorophylls in mutant versus wild-type proteins.

  • Reconstitution into model membranes: Assess the ability of mutant proteins to integrate into membranes and interact with other photosystem components.

  • Computational modeling: Employ QM/MM approaches to predict how specific mutations might alter the electrostatic environment around chlorophylls and thus affect their excitation energies .

  • Functional complementation: For critical mutations, express the mutant gene in a psbB-deficient model organism to assess if it can restore photosynthetic function.

This comprehensive approach would provide insights into structure-function relationships within the CP47 protein and potentially identify key residues for specific functions.

How do the evolutionary adaptations in Pinus koraiensis CP47 compare with those of other Pinus species from different geographical regions?

Evolutionary adaptations in P. koraiensis CP47 likely reflect the species' geographical distribution and ecological niche. Comparative analysis with other Pinus species reveals:

  • P. koraiensis shows intermediate levels of genetic polymorphism (πsil = 0.00652) compared to related species like P. pumila (πsil = 0.00661, highest) and P. griffithii (πsil = 0.00175, lowest) . This genetic diversity likely extends to photosynthetic genes including psbB.

  • Phylogenetic analyses indicate that P. koraiensis and P. griffithii are more closely related to each other than to P. pumila and P. armandii, with divergence between these two groups estimated at approximately 1.37 million years ago .

  • Population structure analysis reveals that P. koraiensis exhibits significant genetic divergence from P. griffithii (FST = 0.62006, highest among compared species pairs) , suggesting potential adaptations to different environmental conditions.

  • Despite genetic divergence, evidence of asymmetric gene flow between Pinus species suggests that adaptive traits, potentially including those related to photosynthetic efficiency, might be shared across species boundaries.

For CP47 specifically, these evolutionary patterns suggest potential adaptations to the cool temperate forests of northeastern China, Korean Peninsula, and Russia where P. koraiensis is native . These adaptations might include optimized excitation energy transfer under forest canopy conditions or enhanced photoprotection mechanisms.

SpeciesSilent Nucleotide Diversity (πsil)Haplotype Diversity (Hd)Average Number of Haplotypes (Nh)
P. koraiensis0.006520.6557.167
P. pumila0.006610.82212.167
P. armandii0.005080.78110
P. griffithii0.001750.4204.167

Table 1: Comparison of genetic diversity metrics across four Pinus species

What molecular mechanisms explain the differential responses of CP47 to varying light conditions in Pinus koraiensis, and how can these be investigated using recombinant protein systems?

Transcriptomic and metabolomic analyses of P. koraiensis under different light conditions provide insights into potential molecular mechanisms governing CP47 responses . To investigate these mechanisms using recombinant protein systems, researchers could:

  • Express CP47 variants: Generate recombinant CP47 proteins corresponding to variants identified in transcriptomic studies of P. koraiensis under different light conditions.

  • Reconstitution experiments: Incorporate recombinant CP47 into liposomes under varying light conditions to assess protein stability and function.

  • Photoprotection assays: Test the hypothesis that flavonoids identified in P. koraiensis under light stress (naringenin chalcone, dihydrokaempferol, and kaempferol) directly protect CP47 by including these compounds in in vitro assays.

  • Transcription factor binding studies: Investigate whether the MYB-related, AP2-ERF, and bHLH transcription factors that increase expression during light stress directly regulate psbB expression.

  • Hormone response elements: Analyze the psbB promoter region for response elements related to hormones implicated in P. koraiensis light stress response.

This multi-faceted approach would connect transcriptomic and metabolomic findings to specific molecular mechanisms affecting CP47 function under varying light conditions.

How can the quantum mechanical properties of chlorophylls in recombinant Pinus koraiensis CP47 be manipulated to enhance photosynthetic efficiency?

Manipulating quantum mechanical properties of chlorophylls in CP47 represents an advanced frontier in photosynthesis research. Based on recent first-principles simulations of light-harvesting complexes , potential approaches include:

  • Site-directed mutagenesis: Target amino acids that interact with specific chlorophylls to alter their site energies. For example, focusing on residues surrounding the B3 and B1 chlorophylls, which have been identified as the most red-shifted in CP47 , could significantly impact energy transfer pathways.

  • Chlorophyll derivatives: Incorporate modified chlorophylls with altered electronic properties during protein reconstitution experiments.

  • Protein engineering: Design rational modifications to alter the electrostatic environment around key chlorophylls based on QM/MM simulations .

  • Species-specific adaptations: Identify and transfer advantageous features from CP47 proteins of other species adapted to different light environments.

  • Quantum coherence enhancement: Modify chlorophyll-protein interactions to potentially enhance quantum coherence effects that might contribute to efficient energy transfer.

Such approaches could potentially lead to enhanced photosynthetic efficiency in either natural or artificial photosynthetic systems, with implications for both basic research and applied technologies.

What are the most common challenges in obtaining pure, functional recombinant CP47 protein, and how can researchers overcome them?

Obtaining pure, functional recombinant CP47 presents several technical challenges:

  • Protein insolubility: As a membrane protein, CP47 may form inclusion bodies in bacterial expression systems. Solution: Optimize growth conditions (lower temperature, reduced inducer concentration) or use membrane protein-specific expression hosts.

  • Improper folding: Complex membrane proteins often misfold in heterologous systems. Solution: Consider using specialized chaperones or expression hosts better suited for membrane proteins.

  • Chlorophyll incorporation: Most expression systems lack chlorophyll biosynthesis pathways. Solution: Express the apoprotein and reconstitute with chlorophyll in vitro, or engineer expression hosts to produce chlorophyll.

  • Protein degradation: The large size and complex structure of CP47 may make it susceptible to proteolysis. Solution: Include protease inhibitors throughout purification and work at reduced temperatures.

  • Aggregation during purification: The hydrophobic nature of CP47 can cause aggregation. Solution: Identify optimal detergents for solubilization and purification, considering recommendations from similar proteins (e.g., Tris/PBS-based buffer with 6% trehalose at pH 8.0) .

  • Storage stability: Purified membrane proteins often lose activity during storage. Solution: Consider lyophilization for long-term storage, with addition of 5-50% glycerol for frozen samples to prevent freeze-thaw damage .

How can researchers accurately distinguish between native structural properties and artifacts introduced during recombinant expression of Pinus koraiensis CP47?

To distinguish native properties from artifacts in recombinant CP47:

  • Comparative spectroscopy: Compare absorption, circular dichroism, and fluorescence spectra of recombinant protein with those of native CP47 isolated from P. koraiensis.

  • Structure validation: Use techniques like limited proteolysis to compare the accessibility of protease sites in native versus recombinant protein.

  • Functional assays: Test the ability of recombinant CP47 to bind other PSII components and transfer energy efficiently.

  • Native-like environments: Compare protein properties in different membrane mimetics (detergent micelles, nanodiscs, liposomes) to identify potential detergent-induced artifacts.

  • Molecular dynamics simulations: Compare the predicted structural stability of recombinant versus native CP47, as has been done for other photosynthetic proteins .

Research on the CP47 antenna has shown that protein structure can be affected when isolated from its native environment , emphasizing the importance of these validation approaches.

How might the study of recombinant Pinus koraiensis CP47 contribute to understanding forest ecosystem responses to climate change?

P. koraiensis is an ecologically important species in northeastern Asian forests, and studying its photosynthetic apparatus could provide insights into forest ecosystem responses to climate change:

  • Adaptability to changing light conditions: Understanding how P. koraiensis CP47 functions under various light conditions could help predict forest understory responses to canopy changes resulting from climate change .

  • Temperature sensitivity: Comparing the thermal stability of P. koraiensis CP47 with that of related species from different climate zones could reveal adaptations to thermal stress.

  • Evolutionary adaptations: The intermediate genetic diversity of P. koraiensis (πsil = 0.00652) suggests potential for adaptive responses to changing conditions, which might be reflected in photosynthetic proteins like CP47.

  • Comparative genomics: Expanding on existing phylogenetic analyses to focus specifically on photosynthetic genes could reveal how different Pinus species have adapted to their respective environments.

  • Biomarker development: CP47 function or modification states could potentially serve as molecular biomarkers for assessing conifer stress responses in changing forest ecosystems.

This research direction would connect molecular-level understanding of photosynthetic proteins to ecosystem-level responses to climate change.

What potential applications exist for engineered variants of Pinus koraiensis CP47 in artificial photosynthetic systems?

Engineered variants of P. koraiensis CP47 could contribute to artificial photosynthetic systems in several ways:

  • Enhanced light-harvesting: By applying insights from quantum mechanical studies of chlorophyll site energies , engineered CP47 variants could offer optimized light-harvesting across specific wavelength ranges.

  • Stress resilience: Adaptations found in P. koraiensis that enable photosynthesis under variable light conditions could be incorporated into artificial systems designed to operate in fluctuating environments.

  • Biohybrid solar cells: Recombinant CP47 proteins could be integrated with semiconductor materials to create biohybrid solar cells that combine the efficiency of biological light-harvesting with the durability of artificial systems.

  • Self-repairing systems: Understanding the turnover and repair mechanisms of CP47 in P. koraiensis could inspire self-healing components in artificial photosynthetic systems.

  • Species-specific optimizations: The unique evolutionary adaptations of P. koraiensis to its native environment might provide blueprints for application-specific optimizations of artificial photosynthetic systems.

Such applications represent the frontier of biomimetic energy research and could contribute to the development of more sustainable solar energy technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.