Recombinant Pinus koraiensis Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

The D2 protein is indispensable for PSII biogenesis and function:

Core functions:

  1. Electron transport: Facilitates charge separation and electron transfer to plastoquinone .

  2. Reaction center stability: Stabilizes the Mn<sub>4</sub>CaO<sub>5</sub> cluster required for water oxidation .

  3. Herbicide interaction: Modulates binding of PSII inhibitors like diuron through the Q<sub>B</sub> pocket .

Assembly regulation:

  • D2 accumulation is a rate-limiting step for PSII RC assembly .

  • In Synechocystis mutants, D2 deletion abolishes PSII activity, underscoring its essential role .

Research Applications of Recombinant D2

The P. koraiensis recombinant D2 protein enables:

ApplicationUtility
Antibody productionStandard for anti-PsbD antibody validation (e.g., Agrisera AS06 146) .
Structural studiesMapping redox-active regions and post-translational modifications .
Herbicide resistance assaysTesting interactions with Q<sub>B</sub>-site inhibitors .

Comparative Data: Recombinant D2 vs. Native Forms

ParameterRecombinant P. koraiensis D2 Native D2 (e.g., pea, Synechocystis)
Expression systemE. coliChloroplast-encoded, assembled in thylakoids
Post-translational modificationsLimited (prokaryotic system)Phosphorylation, oxidation, C-terminal processing
Functional assaysRequires reconstitution with D1/cofactorsActive in native PSII complexes

Challenges & Future Directions

  • Heterodimer dependence: Functional studies require co-expression with D1 and cofactors (e.g., chlorophyll, Mn clusters) .

  • Species-specific variations: Structural insights from Synechocystis or pea may not fully apply to P. koraiensis D2 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Pinus koraiensis (Korean pine)
Target Names
psbD
Target Protein Sequence
MTITLGKSSKEEQTLFDTVDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGSWMSAIGVVGLALNLRAYDFV SQEIRAAEDPESETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors. D2 is essential for assembling a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of the D2 protein in Photosystem II of Pinus koraiensis?

The D2 protein forms one of the two core subunits of the Photosystem II (PSII) reaction center, alongside the D1 protein. In Pinus koraiensis, as in other photosynthetic organisms, this protein plays a vital role in electron transport during the light-dependent reactions of photosynthesis. The D2 protein contains binding sites for cofactors involved in electron transfer, including the non-heme iron and the electron acceptor quinone (QA) . The protein spans the thylakoid membrane with several transmembrane helices and exposed loop regions on both the stromal and lumenal sides .

The D2 protein's function is particularly important in maintaining photosynthetic efficiency under varying light conditions, which is essential for shade-tolerant species like Pinus koraiensis that must adapt to different light intensities in forest environments . The full-length protein consists of 353 amino acid residues, as identified in recombinant studies .

What techniques are commonly used to express recombinant Pinus koraiensis D2 protein?

Recombinant expression of the Pinus koraiensis D2 protein typically employs heterologous expression systems optimized for membrane proteins. The most common methodologies include:

  • Bacterial expression systems: Modified E. coli strains with enhanced membrane protein expression capabilities, often using vectors with inducible promoters like T7 or tac.

  • Cell-free protein synthesis: For difficult-to-express membrane proteins, cell-free systems can provide advantages in avoiding toxicity issues.

  • Codon optimization: The psbD gene sequence is often optimized for the expression host to improve yields.

  • Fusion tags: Addition of solubility or affinity tags (His-tag, MBP, GST) facilitates purification and can enhance protein stability .

For functional studies, researchers often use Tris-based buffers with 50% glycerol to maintain protein stability, with storage recommendations at -20°C or -80°C to prevent degradation .

How do reactive oxygen species (ROS) affect the D2 protein structure and function?

The D2 protein is highly susceptible to oxidative damage by reactive oxygen species (ROS) produced during photosynthesis, particularly under high light conditions. Research has identified several specific residues on the D2 protein that undergo oxidative modifications:

  • D-de loop region: Residues D2:242E, D2:244Y, and D2:245S located on the stromal side near the non-heme iron and QA are particularly vulnerable to oxidation .

  • Luminal side residues: D2:328W, D2:333D, D2:334Q, and D2:336H near the Mn₄O₅Ca cluster can be oxidatively modified during photoinhibition .

  • C-terminal region: Residues D2:341F, D2:342P, D2:343E, D2:344E, and D2:345V on the luminal side are susceptible to oxidation during prolonged light exposure .

The oxidation of D2:244Y, which functions as a bicarbonate ligand for the non-heme iron, is particularly significant as it initiates a cascade of oxidative reactions throughout the D-de loop . These modifications typically reduce electron transport efficiency and ultimately lead to photoinhibition, requiring the degradation and replacement of damaged D2 protein.

Time of IlluminationD2 Protein Residues Oxidatively ModifiedLocationDistance from Functional Centers
0-15 minutes328W, 333D, 334Q, 336HLuminal2.1-32 Å from Mn₄O₅Ca cluster
30 minutes242E, 244Y, 245SStromalNear non-heme iron and QA
30 minutes341F, 342P, 343E, 344E, 345VLuminalVicinity of Mn₄O₅Ca cluster

What methodologies are most effective for studying D2 protein interactions with other photosystem components?

Studying D2 protein interactions with other photosystem components requires specialized techniques that preserve the native structure and interaction interfaces. The most effective methodologies include:

  • Co-immunoprecipitation with antibodies: Using anti-D2 antibodies to pull down interaction partners, followed by mass spectrometry identification. This approach has successfully identified interactions between photosystem proteins and associated light-harvesting complexes .

  • Crosslinking mass spectrometry: Chemical crosslinkers can capture transient interactions before analysis by tandem mass spectrometry. This technique has been valuable for identifying specific residues involved in protein-protein interactions within photosystems .

  • Cryo-electron microscopy: Recent advances in cryo-EM have enabled high-resolution structural analysis of entire photosystem complexes, revealing the precise positioning of D2 relative to other components .

  • FRET-based interaction assays: Fluorescently labeled D2 protein and potential interaction partners can be studied using Förster Resonance Energy Transfer to evaluate binding dynamics in reconstituted systems.

Recent research with cyanobacterial systems has demonstrated how the PBS linker protein ApcG interacts with PSII through its N-terminal region . Similar methodologies could be applied to study interactions between the D2 protein and other components in Pinus koraiensis.

How does light stress affect D2 protein expression and modification in Pinus koraiensis?

Light stress significantly affects D2 protein expression and post-translational modifications in Pinus koraiensis. Under high light conditions, several processes occur:

  • Enhanced turnover rate: The D2 protein undergoes more rapid degradation and replacement due to increased oxidative damage .

  • Phosphorylation changes: Phosphorylation of photosystem proteins, including D2, plays a regulatory role in response to changing light conditions. This post-translational modification affects protein-protein interactions and energy distribution between photosystems .

  • Transcriptional regulation: Transcriptomic analyses reveal that genes involved in photosynthesis, including psbD, show altered expression patterns under different light conditions in Pinus koraiensis .

  • Metabolic adjustments: Light stress triggers changes in flavonoid biosynthesis and other metabolic pathways that may serve protective functions for the photosynthetic apparatus .

Under light-limiting conditions, Korean pine shows significant alterations in hormone levels, with increases in IAA, GA, ABA, SA, CTK, and BR concentrations, while JA levels decrease . These hormonal changes likely influence photosystem protein expression including the D2 protein, though direct correlations require further investigation.

What are the optimal purification strategies for recombinant Pinus koraiensis D2 protein?

Purifying recombinant Pinus koraiensis D2 protein requires specialized approaches due to its hydrophobic nature and membrane association. The optimal purification strategy involves:

  • Two-phase extraction: Initial separation using aqueous two-phase systems with polymers like PEG to separate membrane proteins.

  • Detergent solubilization: Careful selection of detergents (typically mild non-ionic detergents like DDM or digitonin) to solubilize the protein while maintaining native folding.

  • Affinity chromatography: Utilizing fusion tags (commonly His-tags) for initial capture on metal affinity resins.

  • Size exclusion chromatography: Final polishing step to separate monomeric D2 from aggregates and to exchange into stabilizing buffers.

  • Buffer optimization: Tris-based buffers supplemented with 50% glycerol have proven effective for long-term stability .

For structural studies, additional steps may include reconstitution into nanodiscs or liposomes to maintain the protein in a membrane-like environment. Protein quality can be assessed by SDS-PAGE, Western blotting, and circular dichroism to confirm secondary structure integrity.

What analytical techniques are most informative for studying D2 protein oxidative modifications?

The study of oxidative modifications to the D2 protein requires sensitive analytical techniques that can identify specific modified residues. The most informative techniques include:

A typical workflow involves protein isolation under conditions that preserve oxidative modifications, proteolytic digestion, enrichment of modified peptides when necessary, and LC-MS/MS analysis. Data analysis requires specialized software to identify mass shifts associated with various oxidative modifications.

How can researchers effectively design experiments to study D2 protein function in photosynthetic efficiency?

Designing effective experiments to study D2 protein function in photosynthetic efficiency requires a multi-faceted approach:

  • Mutational analysis: Create targeted mutations in the psbD gene based on sequence analysis and expression in suitable host systems. Key regions for mutation include:

    • The D-de loop region, which can accommodate significant changes without destroying function

    • Residues involved in binding cofactors or interacting with other proteins

    • Sites susceptible to oxidative modification

  • Pulse-amplitude modulation (PAM) fluorometry: Measure chlorophyll fluorescence parameters to assess photosynthetic efficiency in vivo:

    • Fv/Fm ratio for maximum quantum efficiency of PSII

    • ΦPSII for effective quantum yield

    • NPQ for non-photochemical quenching

  • Oxygen evolution measurements: Quantify functional impact of mutations or treatments on the water-splitting activity of PSII using Clark-type electrodes.

  • Spectroscopic analysis: Utilize absorption and fluorescence spectroscopy to monitor energy transfer and electron transport:

    • Low-temperature fluorescence to assess energy distribution between PSII and PSI

    • Time-resolved fluorescence to measure excitation energy transfer kinetics

  • Comparative analysis under stress conditions: Test function under various light intensities, temperatures, or in the presence of ROS-generating compounds to assess the role of D2 in stress responses .

How can studies of Pinus koraiensis D2 protein contribute to understanding conifer adaptation to environmental stress?

Research on the Pinus koraiensis D2 protein offers valuable insights into conifer adaptation to environmental stressors, particularly light stress:

  • Shade tolerance mechanisms: As Korean pine is shade-tolerant, studying how its D2 protein responds to low light conditions helps understand photosynthetic adaptations in forest understory environments .

  • Temperature adaptation: Conifers grow in diverse temperature conditions, and the D2 protein's structure and function may reflect adaptations to these environments.

  • ROS management strategies: The specific patterns of oxidative modification in the D2 protein reveal how conifers have evolved to manage reactive oxygen species produced during photosynthesis .

  • Evolutionary adaptations: Comparative analysis of D2 proteins across conifer species can reveal evolutionary adaptations to different ecological niches.

The transcriptomic and metabolomic responses to light stress in Pinus koraiensis show changes in hormone levels, transcription factor expression (including MYB-related, AP2-ERF, and bHLH families), and metabolite accumulation (particularly flavonoids) . Understanding how these changes relate to D2 protein function and regulation provides a more comprehensive picture of stress adaptation mechanisms in conifers.

What are the key considerations for integrating D2 protein studies with other omics data?

Integrating D2 protein studies with other omics data requires careful consideration of several factors:

  • Data normalization and scaling: Different omics platforms produce data with varying scales and distributions that must be appropriately normalized before integration.

  • Temporal alignment: Ensure that samples for different omics analyses are collected at comparable time points in response to treatments or developmental stages.

  • Statistical integration approaches:

    • Network-based methods to identify functional relationships

    • Multi-omics factor analysis to identify coordinated responses

    • Pathway enrichment analyses that incorporate multiple data types

  • Biological context interpretation: Consider:

    • The role of D2 within the broader photosynthetic apparatus

    • Connections between photosynthesis and downstream metabolic pathways

    • Regulatory mechanisms linking transcriptional changes to protein modifications

For Pinus koraiensis specifically, research has shown significant enrichment of pathways including flavonoid biosynthesis, phenylpropanoid biosynthesis, and plant hormone signal transduction under different light conditions . These pathways likely influence D2 protein function and should be considered in integrated analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.