Recombinant Pinus koraiensis Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Pinus koraiensis (Korean pine)
Target Names
psbA
Target Protein Sequence
TAIIERRESANFWSRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENQSANAGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVAGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what role does it play in photosynthesis?

The psbA gene encodes the QB protein of photosystem II, which is essential for oxygenic photosynthetic electron transport. This protein serves as a binding site for several herbicides that target the photosynthetic apparatus . In functional terms, the QB protein participates in the electron transfer chain within photosystem II, accepting electrons from QA and transferring them further along the chain. The protein is crucial for the water-splitting function of photosystem II and ultimately for oxygen evolution during photosynthesis .

How is the psbA gene sequence conserved among different pine species including P. koraiensis?

The psbA gene and its flanking regions show variable conservation patterns among pine species. The trnH-psbA spacer region, often used in DNA barcoding studies, exhibits some variation useful for species discrimination but has limitations . In phylogenetic studies of Pinus species, the trnH-psbA spacer demonstrates comparable length but higher variability than genes like matK and rbcL .

What environmental factors affect psbA expression in P. koraiensis?

Temperature and light intensity significantly influence photosynthetic parameters in P. koraiensis, likely affecting psbA expression and protein function. Research shows that with decreasing temperature, photosynthetic variables in P. koraiensis seedlings tend to decrease . Specifically:

  • Photosynthetic capacity parameters (net photosynthetic rate, stomatal conductance, intercellular CO2 concentration, transpiration rate) are highest at moderate temperatures (6-10°C) and moderate light intensity (750 μmol·m-2·s-1)

  • Photosystem II efficiency parameters (Fv/Fm, ΦPSII, qP, and ETR) significantly decrease with decreasing temperatures, while Fo and NPQ gradually increase

  • The PSII photosynthetic system suffers the least damage at moderate light intensity (750 μmol·m-2·s-1)

  • Both low and high light intensity environments exacerbate damage to the photosynthetic system under low temperature stress

These environmental responses suggest complex regulation of psbA expression and protein function that would need to be considered in recombinant protein studies.

What methodologies are most effective for studying psbA gene expression in P. koraiensis?

Based on current research approaches for conifer gene expression studies, several methodologies show promise for investigating psbA expression in P. koraiensis:

  • Transcriptomic analysis: RNA-seq can identify differential expression patterns of psbA genes under various environmental conditions or developmental stages. This approach has been successfully employed to study gene expression changes in P. koraiensis in response to pathogen infection .

  • qRT-PCR validation: Following transcriptomic analysis, quantitative real-time PCR can confirm expression patterns of psbA genes, as demonstrated in P. koraiensis defense response studies .

  • Proteomics: Mass spectrometry-based proteomics can quantify psbA protein abundance changes. In P. koraiensis studies, protein abundance normalization based on detected peptides has revealed significant differences between experimental conditions .

  • Ribosome profiling (Ribo-seq): This technique can assess translation efficiency by measuring ribosome occupancy on psbA mRNA, providing insights into translational regulation. Research in other plant systems has shown that light conditions affect psbA ribosome occupancy, indicating translational control .

For experimental design, researchers should consider that light conditions significantly affect psbA translation. Studies have shown that factors like RBD1 enhance psbA translation in light but not in dark conditions, while other factors like HCF244 stimulate psbA translation in both light and dark conditions .

What are the challenges in producing functional recombinant psbA protein from P. koraiensis?

Producing functional recombinant psbA protein from P. koraiensis presents several significant challenges:

  • Complex assembly requirements: The psbA protein functions within the multiprotein photosystem II complex. Research on photosystem II assembly factors shows that proteins like RBD1, HCF244, and HCF136 play crucial roles in psbA translation and incorporation into the functional complex . Recombinant expression may lack these assembly factors.

  • Light-dependent regulation: The translation of psbA mRNA is strongly light-regulated, with factors like RBD1 required for light-induced recruitment of ribosomes to psbA mRNA . This light-dependency complicates heterologous expression systems.

  • Membrane integration: As a thylakoid membrane protein, proper folding and integration of recombinant psbA requires specialized expression systems capable of membrane protein production.

  • Post-translational modifications: Any P. koraiensis-specific modifications to the psbA protein must be reproduced in the expression system for full functionality.

  • Conifer-specific challenges: Conifers like P. koraiensis have complex, large genomes and potentially unique regulatory mechanisms that may not be fully replicated in common expression systems.

How does stress response in P. koraiensis potentially affect psbA protein function?

P. koraiensis exhibits complex stress responses that likely involve the photosynthetic apparatus, including the psbA protein. During biotic stress, such as pine wood nematode infection, P. koraiensis shows:

  • Upregulation of stress-response pathways: Transcriptomic analysis has revealed 1574 significantly upregulated genes during early infection stages, including those related to terpenoid, phenylpropanoid, and flavonoid biosynthesis .

  • Proteomic changes: Studies show that 38 proteins significantly differ in abundance between infected and healthy P. koraiensis, with 19 proteins showing increased abundance . These include stress response proteins that may interact with photosynthetic components.

  • Metabolic adjustments: The abundance of various metabolites increases significantly in response to stress, including compounds that may influence photosynthetic efficiency .

For abiotic stress, particularly temperature and light stress, P. koraiensis shows:

  • Photosystem II damage: Low temperature combined with high light intensity causes extensive damage to the PSII photosynthetic system, directly affecting the environment in which psbA protein functions .

  • Both stomatal and non-stomatal limiting factors: These contribute to declining photosynthetic rate under stress conditions, with most severe damage occurring under high light conditions .

What molecular mechanisms regulate light-dependent translation of psbA mRNA in conifers compared to model plants?

Translation of psbA mRNA in plants is regulated by a complex set of factors that respond to light conditions. Based on research in model plants and extrapolating to conifers like P. koraiensis:

  • Translation initiation factors: Several key proteins regulate psbA translation:

    • HCF244 stimulates psbA translation in both light and dark conditions and is required for translation even in the absence of HCF136

    • RBD1 enhances psbA translation specifically in light conditions, functioning as an essential component of the mechanism that senses D1 photodamage

    • HCF136 appears to have a repressive effect on psbA translation that is opposed by RBD1

  • Signal transduction pathway: The current model suggests an ordered action of HCF136, HCF244, and RBD1 in the signal transduction chain underlying light-activated psbA translation . The data indicates:

    • HCF244 has a direct stimulatory effect on translation that operates independently of HCF136

    • RBD1 functions indirectly by opposing HCF136's repressive effect

    • This regulatory circuit responds to D1 photodamage to trigger compensatory psbA translation

  • Ribosome recruitment patterns: Light conditions affect ribosome occupancy on psbA mRNA. RBD1 is required for light-induced recruitment of ribosomes to psbA mRNA but has minimal effect on psbA ribosome occupancy in dark conditions .

While these mechanisms have been studied in model plants, conifers like P. koraiensis may have evolved unique regulatory features due to their evolutionary history and ecological niches. The complex genomes of conifers and their adaptation to various light environments suggest potentially distinct fine-tuning of these regulatory mechanisms.

How can site-directed mutagenesis of recombinant P. koraiensis psbA inform our understanding of herbicide resistance mechanisms?

Site-directed mutagenesis of recombinant psbA can provide valuable insights into herbicide resistance mechanisms since the QB protein is a direct target for several herbicides that bind to the photosynthetic apparatus . A methodological approach would include:

  • Targeting key residues: Based on comparative analysis with Anacystis nidulans, which contains three psbA genes with 25 amino acid differences (out of 360 residues) between psbAI and the identical psbAII/III , researchers can identify critical residues likely involved in herbicide binding.

  • Expression system optimization: Using expression systems that allow proper folding and membrane integration of the mutant proteins, potentially employing cyanobacterial hosts due to their prokaryotic nature but similar photosynthetic machinery.

  • Functional assays: Developing assays to measure:

    • Electron transfer efficiency for normal function

    • Herbicide binding affinity for mutant variants

    • Photosynthetic efficiency under various light and temperature conditions

  • Comparative analysis: Comparing P. koraiensis psbA mutations with known herbicide resistance mutations in model organisms to identify conifer-specific resistance mechanisms.

This research could lead to the development of a comprehensive model of herbicide binding sites in conifer photosystem II and illuminate evolutionary adaptations specific to pine species that might confer natural variation in herbicide sensitivity.

What role might psbA gene variants play in P. koraiensis adaptation to climate change?

P. koraiensis shows complex responses to environmental conditions that suggest psbA variants could significantly impact climate adaptation:

  • Temperature adaptation: Research shows that P. koraiensis photosynthetic parameters are highly sensitive to temperature, with photosynthetic capacity declining as temperatures decrease . psbA variants that optimize function across wider temperature ranges could be critical for adaptation to temperature fluctuations associated with climate change.

  • Light intensity tolerance: P. koraiensis photosystem II suffers different levels of damage depending on light intensity, with moderate light (750 μmol·m-2·s-1) causing the least damage to PSII even under temperature stress . psbA variants that improve function under variable light conditions could enhance resilience.

  • Recovery from photodamage: Since RBD1 has been identified as an essential component of the mechanism that senses D1 photodamage to trigger psbA translation , variants that enhance repair pathways could improve adaptation to stressful conditions that increase photodamage.

Experimental approaches to investigate these adaptations would include:

  • Sequencing psbA genes from P. koraiensis populations across environmental gradients

  • Functional characterization of natural psbA variants under simulated climate change conditions

  • Assessment of photosynthetic efficiency and recovery from photodamage for different variants

  • Correlation of variant distributions with current and projected climate conditions

How does the efficiency of psbA translation compare between gymnosperms like P. koraiensis and angiosperms?

Translation efficiency of psbA mRNA likely differs significantly between gymnosperms like P. koraiensis and angiosperms due to several factors:

  • Evolutionary divergence in translation machinery: Gymnosperms and angiosperms diverged approximately 300 million years ago, potentially leading to distinct translation regulation mechanisms for chloroplast genes.

  • Regulatory factor differences: While both plant groups possess factors like HCF244 that stimulate psbA translation in both light and dark conditions , the specific interactions and efficiencies may differ. Research shows that factors like RBD1 enhance psbA translation specifically in light conditions by opposing HCF136's repressive effect , but the conservation and efficiency of this regulatory circuit across plant lineages remain understudied.

  • Response to environmental conditions: P. koraiensis shows specific photosynthetic responses to temperature and light conditions that may be reflected in specialized psbA translation regulation:

    TemperatureLight Intensity (μmol·m-2·s-1)PSII Damage Level
    6-10°C750 (moderate)Minimal
    <2°C1500 (high)Extensive
    <2°C150 (low)Moderate
  • Methodological considerations for comparative studies:

    • Ribosome profiling to measure ribosome occupancy on psbA mRNA under identical conditions

    • Assessment of translation initiation complex formation rates

    • Quantification of newly synthesized D1 protein under various light and temperature regimes

    • Analysis of translation factor abundance and activity

How can CRISPR-Cas9 technology be optimized for studying psbA function in P. koraiensis?

CRISPR-Cas9 technology presents unique challenges when applied to conifers like P. koraiensis, particularly for chloroplast genes like psbA. A methodological approach would include:

  • Chloroplast transformation considerations: Since psbA is encoded in the chloroplast genome, researchers must:

    • Develop chloroplast-targeted CRISPR systems

    • Optimize delivery methods specific to conifer chloroplasts

    • Design homology-directed repair templates compatible with the chloroplast genome

  • Target site selection: Based on comparative genomics, researchers should:

    • Identify conserved regions suitable for guide RNA design

    • Avoid regions with potential off-target effects in the nuclear genome

    • Target functional domains identified through comparative analysis with model systems

  • Validation strategies:

    • Develop PCR-based screening methods to detect edited chloroplast genomes

    • Establish protocols to quantify heteroplasmy (mixed edited/unedited chloroplast population)

    • Implement functional assays to assess photosynthetic efficiency in edited tissues

  • Tissue culture optimization: Develop regeneration protocols optimized for:

    • Maintaining edited chloroplast populations through development

    • Efficient regeneration of edited P. koraiensis tissues

    • Acclimatization procedures for regenerated plants

What insights can structural biology provide about P. koraiensis psbA compared to model organisms?

Structural biology approaches can reveal critical information about P. koraiensis psbA protein:

  • Comparative structural analysis: Modeling the P. koraiensis psbA protein structure based on:

    • Sequence comparisons with cyanobacterial psbA proteins, which show 25 amino acid differences out of 360 residues between variants

    • Crystal structures of photosystem II from model organisms

    • Prediction of conifer-specific structural adaptations

  • Functional domain characterization: Analysis focusing on:

    • Herbicide binding regions, as psbA is a target for herbicides that bind directly to the photosynthetic apparatus

    • Electron transfer interfaces critical for photosynthetic function

    • Protein-protein interaction surfaces with other photosystem II components

  • Structure-function relationships: Investigation of:

    • How temperature-dependent conformational changes might explain P. koraiensis photosynthetic responses across temperature gradients (10°C to -6°C)

    • Structural basis for different damage patterns observed under various light intensities

    • Molecular mechanism of RBD1's opposition to HCF136's repressive effect on psbA translation

  • Methodological approaches:

    • Cryo-EM of isolated P. koraiensis photosystem II complexes

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic regions

    • Molecular dynamics simulations under varying temperature conditions to predict thermal adaptation mechanisms

How does the interplay between transcription, translation and protein turnover of psbA differ in P. koraiensis compared to model plants?

Research suggests complex regulation of psbA at multiple levels:

  • Transcriptional regulation: Analysis of P. koraiensis under stress conditions shows that transcriptional responses involve multiple interconnected pathways . For psbA specifically:

    • Studies in other systems show psbA mRNA abundance remains relatively stable regardless of light conditions (Fig. 2C in )

    • P. koraiensis may have evolved specific transcriptional regulation patterns adapted to its ecological niche

  • Translational regulation: Light-dependent translation appears to be a primary control point:

    • RBD1 enhances psbA translation specifically in light conditions but not in darkness

    • HCF244 stimulates translation in both light and dark conditions

    • These regulatory patterns reflect the need to rapidly replace photodamaged D1 protein

  • Protein turnover: The D1 protein encoded by psbA has one of the highest turnover rates in the thylakoid membrane due to photodamage:

    • P. koraiensis shows specific photosynthetic responses to temperature and light stress

    • The PSII photosynthetic system suffers varying degrees of damage depending on light intensity and temperature

    • Both stomatal and non-stomatal limiting factors contribute to declining photosynthetic rate under stress conditions

  • Integration of regulatory levels: A comprehensive model would include:

    • Signal transduction pathways sensing D1 photodamage

    • Coordination between chloroplast and nuclear gene expression

    • Adaptation of these regulatory networks to P. koraiensis's specific ecological requirements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.