Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 1A, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein type 2 member 1A, chloroplastic; Chlorophyll a-b binding protein type II 1A; CAB; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-278
Protein Length
Full Length of Mature Protein
Species
Pinus sylvestris (Scots pine)
Target Protein Sequence
RKATGKKSVAASIDSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLI HAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVK EIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can site-directed mutagenesis elucidate structure-function relationships in this protein?

Site-directed mutagenesis provides powerful insights into the functional importance of specific amino acid residues in Pinus sylvestris Chlorophyll a-b binding protein:

  • Strategic Target Selection:

Target TypeRationaleExample Residues
Chlorophyll coordination sitesDisrupt pigment bindingConserved histidines
Formyl group interaction sitesAlter chlorophyll b bindingPolar amino acids near binding pocket
Protein-protein interfacesModify complex assemblySurface-exposed residues
Transmembrane anchorsInvestigate membrane integrationHydrophobic residues in α-helices
  • Mutation Design Strategy:

    • Conservative substitutions: Maintain similar chemical properties to subtly alter interactions

    • Non-conservative substitutions: Dramatically change properties to abolish specific interactions

    • Alanine scanning: Systematically replace residues with alanine to identify essential amino acids

  • Functional Consequences Assessment:

    • Changes in chlorophyll a:b binding ratios

    • Altered spectroscopic properties (absorption, fluorescence, energy transfer efficiency)

    • Modified protein stability and assembly into larger complexes

Studies have shown that single amino acid substitutions (e.g., from Asn to Gln) can dramatically shift spectral properties, indicating that small protein changes can have large effects on pigment binding and function .

  • What cross-linking approaches can investigate protein-protein interactions involving this chlorophyll binding protein?

Several cross-linking strategies can capture transient or stable interactions between Pinus sylvestris Chlorophyll a-b binding protein and other photosynthetic components:

  • Chemical Cross-linking Methods:

    • EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide): A water-soluble carbodiimide that creates zero-length cross-links between carboxyl and amino groups

    • DTSSP (3,3′-dithiobis(sulfosuccinimidylpropionate)): A thiol-cleavable cross-linker valuable for reversible cross-linking

  • Cross-linking Protocol Example:

    • Resuspend samples at 0.2 mg/mL chlorophyll a in buffer (25% glycerol, 10 mM MgCl₂, 5 mM CaCl₂, 50 mM Hepes, pH 7.5)

    • Incubate with 10 mM DTSSP for 30 minutes in dark at 23°C

    • Terminate reaction with 50 mM Tris-Cl (pH 7.5) followed by desalting

  • Analysis of Cross-linked Products:

    • 2D diagonal electrophoresis to resolve cross-linked complexes

    • Mass spectrometry to identify cross-linked peptides

    • Immunodetection with specific antibodies to confirm interaction partners

These approaches have successfully identified interactions between photosynthetic proteins, such as the binding of Psb27 to chlorophyll binding proteins in photosystem II complexes .

  • How do environmental conditions affect expression and function of this protein in Scots pine?

The expression and function of Pinus sylvestris Chlorophyll a-b binding protein responds dynamically to environmental conditions through several mechanisms:

  • Light Response Adaptations:

    • Unlike angiosperms, Scots pine can synthesize chlorophyll in dark conditions

    • Dark-grown primary needles contain chlorophyll a and b along with their binding proteins

    • The first chlorophyll form detected in dark-grown pine needles has an emission maximum at 678 nm

  • Water Stress Response:

    • Hyperspectral imaging reveals differential responses in carotenoid and chlorophyll-related parameters

    • The photochemical reflectance index (PRI) partially recovers after rewatering

    • Chlorophyll-related red edge position (REP) shows no recovery after water stress

  • Genetic Adaptation to Climate:

    • Population genetic structure analysis reveals differentiation between highland and lowland populations

    • Chloroplast SSR markers show stronger population differentiation (PhiST = 0.240) than nuclear markers

    • Temperature gradients drive phenology-based genetic networks affecting gene expression patterns

  • Inhibitor Effects on Synthesis:

    • Norflurazon strongly inhibits both carotenoid and chlorophyll synthesis

    • Treated plants show low chlorophyll content and accumulate carotenoid precursors

    • Photosystem I emission at 735 nm is completely absent in treated plants

These responses indicate sophisticated regulatory mechanisms that tune photosynthetic capacity to environmental conditions.

  • What are the research applications of recombinant Pinus sylvestris Chlorophyll a-b binding protein?

Recombinant Pinus sylvestris Chlorophyll a-b binding protein offers diverse applications in photosynthesis research:

  • Comparative Photosynthesis Studies:

    • Investigation of gymnosperm-specific adaptations in light harvesting

    • Comparison with angiosperm homologs to identify evolutionary innovations

    • Analysis of conifer-specific mechanisms like dark chlorophyll synthesis

  • Structural Biology Applications:

    • Crystallization trials for high-resolution structure determination

    • Cryo-electron microscopy studies of protein complexes

    • NMR investigations of protein dynamics and pigment interactions

  • Protein Engineering Approaches:

    • Creation of chimeric proteins combining domains from different species

    • Development of proteins with enhanced spectral properties or stability

    • Engineering of proteins with modified pigment binding preferences

  • Photosynthetic Efficiency Research:

    • Investigation of energy transfer mechanisms in conifer photosystems

    • Analysis of adaptation to environmental stressors

    • Development of in vitro models for photosynthetic light harvesting

  • Plant Biotechnology Applications:

    • Design of transgenic plants with modified light-harvesting capabilities

    • Development of stress-resistant variants for agriculture

    • Engineering of plants with enhanced photosynthetic efficiency

These applications contribute to both fundamental understanding of photosynthesis and applied research aimed at improving plant productivity.

  • How can molecular evolution of chlorophyll binding proteins be studied across plant lineages?

Investigating the evolutionary trajectory of chlorophyll binding proteins requires integration of several approaches:

  • Genomic Analysis Methods:

    • Whole-genome resequencing as performed for Scots pine for the Axiom Psyl50K array development

    • Analysis of both genic and intergenic regions to identify evolutionary signatures

    • Comparative genomics across diverse plant lineages

  • Molecular Evolution Metrics:

    • Calculation of Ka/Ks ratios to identify selection pressures

    • Identification of conserved vs. variable regions across lineages

    • Dating of gene duplication and divergence events

  • Structural Comparisons:

    • Homology modeling based on crystallographic data

    • Identification of conserved structural motifs despite sequence divergence

    • Analysis of how structural variations impact function

  • Functional Evolution Assessment:

    • Reconstruction and testing of ancestral protein sequences

    • Comparative biochemical analysis of proteins from different lineages

    • Investigation of novel functions that emerged during evolution

The 90% sequence homology between Scots pine and angiosperm LHC-II proteins despite hundreds of millions of years of separate evolution indicates strong functional constraints on these essential photosynthetic components .

Methodological Considerations

  • What are the optimal approaches for pigment-protein reconstitution experiments?

Reconstituting Pinus sylvestris Chlorophyll a-b binding protein with chlorophyll molecules requires careful methodological control:

  • Pigment Preparation Protocols:

    • Extraction from plant material using organic solvents

    • HPLC purification to separate chlorophyll a and b

    • Preparation of stock solutions in suitable organic solvents

  • Reconstitution Methods:

MethodProcedureAdvantagesChallenges
Detergent-mediatedSolubilize protein in mild detergent, add chlorophylls graduallySimple, reproducibleMay not fully mimic native environment
Lipid-basedIncorporate protein and pigments into liposomes or nanodiscsBetter mimics native membraneMore technically demanding
Mixed micelleCombine detergent-solubilized protein with pigment-containing micellesEfficient incorporationRequires detergent removal
  • Optimization Parameters:

    • Protein:pigment ratio: Initially 1:10, adjusted based on results

    • Buffer composition: Typically Tris or phosphate buffers at pH 7.5-8.0

    • Temperature: 4°C to minimize pigment degradation

    • Light conditions: Green safe light to prevent photooxidation

  • Success Verification Methods:

    • Absorption spectroscopy (red shifts relative to free pigments)

    • Fluorescence emission spectra (characteristic peaks at 678, 685, 695, and 735 nm)

    • Circular dichroism (excitonic coupling signatures)

    • Size exclusion chromatography (complex homogeneity)

These approaches provide a foundation for studying chlorophyll-protein interactions in a controlled, reproducible manner.

  • How should affinity tags be designed and removed for optimal protein function?

Designing and removing affinity tags from recombinant Pinus sylvestris Chlorophyll a-b binding protein requires careful consideration of several factors:

  • Tag Selection Considerations:

    • His-tag is commonly used for this protein (typically N-terminal)

    • Size and position of tag affects expression and purification efficiency

    • Tag location may influence protein folding and function

  • Protease Cleavage Site Introduction:

    • Using recombinant DNA techniques, a protease cleavage site can be introduced between the tag and target protein

    • This enables tag removal after purification

  • Protease Selection Criteria:

    • Specificity for the introduced cleavage site

    • Minimal non-specific cleavage of the target protein

    • Compatibility with buffer conditions that maintain protein stability

    • Ease of removal after the cleavage reaction

  • Design Considerations for Removable Tag Construction:

    • The cleavage site should be accessible to the protease

    • Sufficient spacing between tag and protein to prevent steric hindrance

    • Sequence context that doesn't interfere with protease recognition

    • Consideration of downstream applications requiring tag-free protein

When designing constructs, it's important to recognize that affinity tags may interfere with the native function of the target protein, making their removal essential for certain functional studies .

  • What spectroscopic methods best characterize chlorophyll-protein interactions?

Several advanced spectroscopic techniques provide complementary insights into chlorophyll-protein interactions:

  • 77K Fluorescence Spectroscopy:

    • Performed at liquid nitrogen temperature (77K)

    • Resolves emission bands that overlap at room temperature

    • Reveals specific emission maxima (678, 685, 695, and 735 nm) corresponding to different chlorophyll-protein complexes

    • Has been successfully used to analyze chlorophylls in pine needles

  • Circular Dichroism (CD) Spectroscopy:

    • Visible region CD spectra reveal excitonic coupling between chlorophyll molecules

    • The typical behavior attributed to excitonic coupling among pigments is observed in chlorophyll-protein complexes

    • This confirms the presence of organized pigment arrangements within the protein

  • Absorption Spectroscopy:

    • High-performance liquid chromatography (HPLC) coupled with absorbance detection quantifies pigment content

    • The presence of the formyl group in chlorophyll b produces characteristic spectral shifts

    • Differential absorption properties between chlorophyll a and b complexes provide insights into binding interactions

  • Time-Resolved Spectroscopy:

    • Measures fluorescence lifetimes and energy transfer kinetics

    • Reveals how excitation energy moves between pigments within the complex

    • Provides dynamic information about the functional efficiency of the complex

These methods collectively provide a comprehensive characterization of both structural and functional aspects of chlorophyll-protein interactions.

  • What are the challenges in structural studies of conifer chlorophyll binding proteins?

Structural determination of Pinus sylvestris Chlorophyll a-b binding protein faces several technical challenges:

  • Protein-Pigment Complex Stability:

    • Maintaining native associations between protein and chlorophylls during purification

    • Preserving functional interactions among multiple pigment molecules

    • Stabilizing the complex during crystallization or other structural studies

  • Membrane Protein Challenges:

    • Detergent selection for extraction from membranes without disrupting structure

    • Finding conditions that maintain native folding outside the membrane environment

    • Preventing aggregation during concentration for structural studies

  • Heterogeneity Issues:

    • Natural variation in bound pigments (chlorophyll a:b ratios)

    • Post-translational modifications introducing sample heterogeneity

    • Multiple protein isoforms with subtle structural differences

  • Technical Limitations:

    • Difficulties in growing diffraction-quality crystals of membrane proteins

    • Size limitations for NMR studies of complete protein-pigment complexes

    • Sample preparation challenges for cryo-electron microscopy

  • Alternative Approaches:

    • Advanced microscopy methods like cryo-EM to explore protein structure

    • Integration of spectroscopic data with computational modeling

    • Divide-and-conquer approaches focusing on specific domains

Recent advances in structural biology techniques, particularly cryo-electron microscopy, offer promising avenues for overcoming these challenges .

  • How can genomic approaches advance understanding of this protein?

Genomic technologies provide powerful tools for studying Pinus sylvestris Chlorophyll a-b binding protein in its broader genetic context:

  • Whole-Genome Sequencing Applications:

    • The development of the Axiom Psyl50K array demonstrates how whole-genome resequencing facilitates genetic studies in Scots pine

    • This array represents both genic and intergenic regions, enabling comprehensive genetic analysis

    • Such tools allow mapping of genetic variations affecting protein structure and function

  • Population Genomics Insights:

    • Genetic structure analysis reveals differentiation between highland and lowland populations

    • Chloroplast SSR markers show stronger population differentiation than nuclear markers

    • These approaches identify adaptations to different environmental conditions

  • Comparative Genomics Strategies:

    • Analysis of gene structure across species reveals evolutionary constraints

    • Identification of conserved regulatory elements controlling expression

    • Study of gene family evolution through duplication and divergence

  • Functional Genomics Applications:

    • Transcriptomic analysis of expression patterns under various conditions

    • Identification of co-expressed genes in photosynthetic pathways

    • Characterization of regulatory networks controlling protein expression

  • Genetic Engineering Approaches:

    • Transformation methods like particle bombardment have been demonstrated in Scots pine

    • These techniques enable production of transgenic plants for functional studies

    • Although transformation efficiency is currently low (1/14999), the possibility exists for genetic manipulation

These genomic approaches connect protein-level studies to broader biological contexts, enhancing understanding of how chlorophyll binding proteins function within the complex genetic networks of conifers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.