Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 1B, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein type 2 member 1B, chloroplastic; Chlorophyll a-b binding protein type II 1B; CAB; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-274
Protein Length
Full Length of Mature Protein
Species
Pinus sylvestris (Scots pine)
Target Protein Sequence
RKATTKKLTASASTSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPENFA KNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLV HAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVK EIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does LHCB2.1 differ from other LHCB proteins in function and organization?

LHCB proteins in plants comprise several distinct types (Lhcb1-6), with Lhcb1, Lhcb2, and Lhcb3 forming the trimeric LHCII complexes, while Lhcb4, Lhcb5, and Lhcb6 exist as monomeric proteins associated with photosystem II . The Pinus sylvestris LHCB2.1 protein is functionally similar to angiosperm LHCB2 proteins but with gymnosperm-specific adaptations.

Research with Arabidopsis mutants demonstrates that Lhcb2 has specialized functions not shared by other LHCB proteins:

  • Lhcb2 is specifically required for the formation of the state transition-specific PSI-LHCII complex, with Lhcb2-deficient plants unable to form this complex even when Lhcb1 is present .

  • Unlike Lhcb1, Lhcb2 is not essential for normal PSII supercomplex structure, as Lhcb1 can form homotrimers that maintain supercomplex organization in the absence of Lhcb2 .

  • While both proteins accumulate under low-light conditions, their responses to light quality and phosphorylation patterns differ, suggesting distinct regulatory mechanisms .

What are the optimal methods for recombinant expression of Pinus sylvestris LHCB2.1?

Successful recombinant expression of Pinus sylvestris LHCB2.1 has been achieved using E. coli expression systems. The methodology involves:

  • Expression construct design: The mature protein sequence (amino acids 42-274) is fused to an N-terminal His-tag to facilitate purification without interfering with the C-terminal membrane integration domain .

  • Expression conditions: While specific conditions vary between laboratories, common optimizations include:

    • Induction at lower temperatures (16-20°C) to facilitate proper folding

    • Use of specialized E. coli strains designed for membrane protein expression

    • Careful optimization of induction timing and inducer concentration

  • Protein extraction and purification: The protein can be isolated using affinity chromatography via the His-tag, followed by additional purification steps if needed .

The recombinant protein is typically obtained as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . For functional studies requiring properly folded protein with bound pigments, additional reconstitution steps are necessary.

What challenges exist in maintaining stability of recombinant LHCB proteins?

Several challenges exist in maintaining the stability of recombinant LHCB proteins:

  • Storage considerations: The protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use. Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided .

  • Buffer optimization: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been found effective for maintaining stability during storage .

  • Reconstitution protocol: For optimal results, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (final concentration) for long-term storage .

  • Working aliquot handling: For ongoing experiments, working aliquots can be stored at 4°C for up to one week, but longer storage requires freezing under optimized conditions .

Storage ConditionRecommended ProtocolStability Period
Long-term storage-20°C/-80°C with 50% glycerolSeveral months
Working aliquots4°CUp to one week
Reconstituted protein0.1-1.0 mg/mL in deionized waterUse immediately or add glycerol

How can researchers investigate the role of LHCB2.1 in state transitions?

State transitions represent a short-term adaptation mechanism that optimizes photosynthetic efficiency by redistributing excitation energy between photosystems. To investigate LHCB2.1's role in this process, researchers can employ several methodologies:

  • Low-temperature fluorescence spectroscopy: This technique allows detection of changes in PSI and PSII fluorescence at around 730 nm and 680 nm, respectively. In wild-type plants, a state 1–state 2 transition causes an increase in PSI fluorescence relative to PSII fluorescence due to the functional attachment of LHCII trimers transferring from PSII to PSI .

  • Pulse amplitude-modulated (PAM) chlorophyll fluorescence: This method provides a second, independent measurement of state transitions. The typical fluorescence trace in wild-type plants shows an exponential decline in fluorescence with a half-life of approximately 2 minutes during energy redistribution to PSI .

  • Blue native gel electrophoresis with differential solubilization: Using either β-DM or digitonin to solubilize thylakoid membranes followed by lpBN gel electrophoresis allows visualization of different protein complexes. The state transition-specific PSI-LHCII complex can be identified using this method .

  • Phosphorylation analysis: Since LHCB phosphorylation is critical for state transitions, immunoblotting with phospho-specific antibodies can track the phosphorylation state of LHCB proteins under different light conditions .

Research has shown that plants lacking Lhcb2 (amiLhcb2) cannot form the state transition-specific PSI-LHCII complex despite having normal levels of Lhcb1, highlighting the unique role of Lhcb2 in this process .

What methods are used to study the involvement of LHCB proteins in hormone signaling pathways?

Recent research has revealed unexpected roles for LHCB proteins in hormone signaling, particularly in abscisic acid (ABA) responses. To investigate these functions, researchers employ several approaches:

  • Chromatin immunoprecipitation (ChIP) assays: This technique allows quantitative determination of transcription factor binding to LHCB promoters. For example, ChIP assays have demonstrated that the WRKY40 transcription factor binds to LHCB promoters and regulates their expression in response to ABA .

  • Reporter gene assays: These assays use constructs with LHCB promoters linked to reporter genes such as luciferase (LUC). The promoter regions can be isolated using PCR with specific primers, and the constructs can be used to study transcriptional regulation in response to hormones .

  • Phenotypic analysis of LHCB-deficient plants: Downregulation of LHCB genes has been shown to result in ABA-insensitive phenotypes in seed germination and post-germination growth, demonstrating positive involvement of LHCB proteins in these developmental processes .

  • Gene expression analysis: ABA has been shown to be required for full expression of different LHCB members, with physiologically high levels of ABA enhancing LHCB expression. This can be monitored using quantitative RT-PCR or other gene expression methods .

How does LHCB2.1 contribute to photoprotection and nonphotochemical quenching?

Nonphotochemical quenching (NPQ), particularly the rapidly reversible energy-dependent component (qE), is a critical photoprotective mechanism that dissipates excess excitation energy as heat. Research on the role of different LHCB proteins in this process reveals:

  • LHCB composition affects qE capacity: Plants with reduced Lhcb1 (amiLhcb1) show decreased qE quenching, while plants lacking only Lhcb2 (amiLhcb2) maintain normal qE comparable to wild-type plants .

  • Antenna size correlation: The reduction in qE in Lhcb1-deficient plants appears to be a direct effect due to a lack of quenching sites rather than an indirect effect on triggering mechanisms, as demonstrated by experiments with double mutants .

  • High light response: Under high light conditions, the inability of Lhcb1-deficient plants to induce qE results in the plastoquinone (PQ) pool becoming greatly reduced, suggesting impaired photoprotection .

  • LHCII-PsbS interaction: Studies using liposomes composed of LHCII, PsbS, and zeaxanthin demonstrate that carotenoid-dependent quenching occurs via direct interactions of LHCII with PsbS .

What is known about the role of LHCB proteins in plant adaption to fluctuating light conditions?

Plants in natural environments frequently experience fluctuating light conditions, necessitating rapid adaptation mechanisms. Research on LHCB proteins reveals:

  • Growth under fluctuating light: When exposed to fluctuating light conditions (alternating between low and high light intensities), both Lhcb1-deficient (amiLhcb1) and Lhcb2-deficient (amiLhcb2) plants show stunted growth compared to wild-type plants .

Plant TypeGrowth Under Constant LightGrowth Under Fluctuating Light
Wild-typeNormal386.43 ± 37.49 mg
amiLhcb1Slower, paler leaves142.55 ± 19.34 mg
amiLhcb2Similar to wild-type154.72 ± 22.54 mg
  • Pigment composition effects: Lhcb1-deficient plants show approximately 30% reduction in chlorophyll content compared to wild-type plants, with an increased chlorophyll a/b ratio of 4.0 versus 3.2 in wild-type .

  • PSII supercomplex structure: Under varying light conditions, Lhcb1-deficient plants show altered PSII supercomplex composition, with fewer LHCII trimers attached to PSII reaction centers .

  • Plastoquinone pool regulation: The ability to maintain an optimally oxidized plastoquinone pool despite fluctuations in light intensity depends on both state transitions and qE mechanisms, with different LHCB proteins playing distinct roles in these processes .

What are the common pitfalls in functional assays with recombinant LHCB proteins?

When conducting functional assays with recombinant LHCB proteins, researchers commonly encounter several challenges:

  • Pigment incorporation: As recombinant LHCB proteins expressed in E. coli lack chlorophyll and other pigments, proper reconstitution with pigments is necessary for functional studies. Incomplete or improper pigment incorporation can lead to misleading results in spectroscopic and functional assays.

  • Protein aggregation: LHCB proteins are prone to aggregation due to their hydrophobic nature. This can be mitigated by careful buffer optimization, use of appropriate detergents, and maintaining optimal protein concentration during experiments .

  • Photobleaching: Extended exposure to light during experimental procedures can cause photobleaching of chlorophyll and other pigments, affecting the accuracy of results. Experiments should be designed to minimize unnecessary light exposure.

  • Proper controls: When studying specific LHCB isoforms like LHCB2.1, appropriate controls are essential. Research has shown that single T-DNA knockout mutants may not show significant phenotypes due to functional redundancy among LHCB proteins .

  • Storage and stability issues: Recombinant LHCB proteins may lose activity during storage. Following recommended storage protocols, including aliquoting to avoid freeze-thaw cycles and maintaining appropriate buffer conditions, is crucial for reliable results .

How can researchers optimize thylakoid membrane protein complex analysis?

Analysis of membrane protein complexes such as LHCII requires specialized techniques due to their hydrophobic nature and complex organization. Best practices include:

  • Detergent selection for solubilization:

    • β-dodecyl maltoside (β-DM) is suitable for visualizing mainly grana core complexes

    • Digitonin is preferred for studying larger complexes including PSI-LHCII state transition-specific complexes

  • Blue native gel electrophoresis optimization:

    • Optimize sample concentration to avoid overloading

    • Use lpBN (low percentage blue native) gel systems for better separation of large supercomplexes

    • Maintain cold conditions throughout the procedure to preserve complex integrity

  • Complex identification and quantification:

    • Different PSII-LHCII supercomplexes (C₂S, C₂S₂, C₂S₂M, C₂S₂M₂) can be distinguished based on their migration patterns

    • The state transition-specific PSI-LHCII complex migrates at a characteristic position

    • Densitometric analysis of complex bands provides quantitative data on complex abundance

  • State transition studies:

    • Ensure proper light conditions to establish state 1 (PSI light) or state 2 (PSII light) before membrane isolation

    • Compare samples in both states to identify state-dependent changes in complex composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.