Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2

Shipped with Ice Packs
In Stock

Description

Introduction

Light-harvesting chlorophyll a/b-binding (LHCB) proteins are apoproteins that form the light-harvesting complex of photosystem II . In Pinus sylvestris (Scots pine), these proteins are essential for capturing light energy and initiating photosynthesis . Recombinant DNA technology allows for the production of these proteins in large quantities for research and industrial applications .

Gene Identification and Cloning

Researchers constructed a cDNA library from mRNA extracted from light-treated Pinus sylvestris seedlings to identify cDNA for chlorophyll a/b-binding protein LHC-II . Utilizing a pea gene as a heterologous probe, they identified and sequenced three cDNA clones . The deduced amino acid sequences revealed two Type I genes and one Type II LHC-II protein, displaying approximately 90% homology with their angiosperm counterparts .

Protein Characteristics and Function

LHCB proteins, including Type 2 Member 2, bind chlorophyll a and b, which are crucial for light absorption . These proteins are integral components of the light-harvesting complex II (LHCII), the most abundant membrane protein complex in photosynthetic organisms . LHCII plays a pivotal role in gathering light energy and transferring it to the photosystems in the thylakoid membranes of chloroplasts .

Expression and Purification

Recombinant Pinus sylvestris Chlorophyll a-b Binding Protein Type 2 Member 2 can be expressed in Escherichia coli and purified for various biochemical and biophysical studies . Affinity purification techniques, such as using a His-tag, facilitate the isolation of the recombinant protein .

Functional Significance in Plants

  • Light Harvesting: LHCB proteins are essential for capturing and transferring light energy to the photosynthetic reaction centers .

  • Abscisic Acid (ABA) Response: LHCB proteins are involved in ABA-mediated responses during seed germination and post-germination growth .

  • Stress Adaptation: LHCB expression is fine-tuned by ABA and WRKY40 transcription factors, enabling plants to adapt to environmental challenges .

Chlorophyll Binding Domains (CBDs)

Type-II water-soluble chlorophyll (Chl) proteins (WSCPs) have Chlorophyll-binding domains (CBDs) :

  • CBD1: A 17-residue $$ \beta $$-hairpin that extends across the Chl’s macrocycle .

  • CBD2: A loop extending from CBD1, forming hydrogen bonds to carbonyl side groups of Chl rings IV and V .

  • CBD3 and CBD4: Loops of 8- or 10-residues and a 4- or 3-residue beta-turn that interact with Chl rings II and I, respectively .

Applications in Research

  • Photosynthesis Research: Recombinant LHCB proteins are used to study the mechanisms of light harvesting and energy transfer in photosynthesis.

  • Biotechnology: These proteins can be employed in creating artificial photosynthetic systems for renewable energy production.

  • Stress Response Studies: Investigating the role of LHCB proteins in plant responses to environmental stresses such as drought and high light intensity.

Data Table: Characteristics of Pinus sylvestris LHCB Proteins

FeatureDescription
Protein TypeChlorophyll a/b-binding protein Type 2 Member 2
Source SpeciesPinus sylvestris (Scots pine)
Molecular WeightVaries depending on post-translational modifications
Spectral PropertiesBinds chlorophyll a and b; absorption spectra depend on the protein environment
Subcellular LocalizationChloroplast thylakoid membranes
FunctionLight harvesting, energy transfer, and regulation of photosynthesis
Recombinant ExpressionExpressed in E. coli with a His-tag for purification
HomologyApproximately 90% homologous to angiosperm counterparts
cDNA Characteristics70-75% preference for G + C in the third base position
Transit PeptideSimilar features to angiosperm transit peptides, facilitating transport into chloroplasts

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein type 2 member 2; Chlorophyll a-b binding protein type II 2; CAB; LHCP; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Pinus sylvestris (Scots pine)
Target Protein Sequence
ELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYR VGGGPLGEGLDPLYPGDAFDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTG KGPIENLYDHLADPVANNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Chlorophyll a-b binding protein type 2 member 2 in photosynthesis?

The Chlorophyll a-b binding protein type 2 member 2 from Pinus sylvestris (Scots pine) functions as a light receptor in the light-harvesting complex (LHC). It captures and delivers excitation energy to photosystems with which it is closely associated . This protein belongs to the light-harvesting chlorophyll a/b-binding protein family and plays a critical role in the initial stages of photosynthesis.

Functionally, this protein:

  • Binds approximately 14 chlorophylls (8 Chl-a and 6 Chl-b) and carotenoids such as lutein and neoxanthin

  • Forms part of the LHC complex that optimizes light capture under varying conditions

  • Integrates into the thylakoid membrane as a multi-pass membrane protein

  • Participates in the distribution of excitation energy between photosystems I and II

  • Is regulated by reversible phosphorylation of threonine residues

The N-terminus of the protein extends into the stroma where it is involved with adhesion of granal membranes and post-translational modifications, both of which are believed to mediate the distribution of excitation energy between photosystems .

What expression systems and conditions are optimal for producing functional recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2?

Based on available research data, E. coli is the predominantly used expression system for this protein . The optimal expression conditions include:

  • Vector selection and design:

    • Use vectors with strong but inducible promoters

    • Include appropriate affinity tags (His-tag is common)

    • Consider codon optimization for E. coli expression

  • Culture conditions:

    • Grow cultures at 37°C until induction

    • Reduce temperature to 18-25°C after induction to promote proper folding

    • Induce with appropriate concentration of inducer (e.g., IPTG)

    • Extend expression time (16-24 hours) at lower temperatures

  • Cell lysis and protein extraction:

    • Use mild detergents to solubilize the membrane protein

    • Include protease inhibitors to prevent degradation

    • Consider inclusion body isolation and refolding protocols if the protein forms inclusion bodies

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography to separate monomeric from aggregated forms

    • Ion exchange chromatography as an additional purification step if needed

Alternative expression systems such as yeast, baculovirus, or mammalian cells may be considered if post-translational modifications are important for the study .

What are the recommended storage and handling conditions to maintain protein stability and activity?

For optimal stability of the recombinant protein, the following storage and handling conditions are recommended :

ConditionRecommendation
Short-term storage4°C for up to one week
Long-term storage-20°C for regular storage; -80°C for extended periods
Buffer compositionTris-based buffer with 50% glycerol, optimized for protein stability
Freeze-thaw cyclesAvoid repeated freeze-thaw cycles; make small working aliquots
ReconstitutionFor lyophilized preparations, reconstitute in deionized sterile water to 0.1-1.0 mg/mL
AdditivesAddition of 5-50% glycerol is recommended; default final concentration is 50%

The research literature emphasizes that repeated freezing and thawing should be strictly avoided as it can lead to protein denaturation and loss of activity . For experiments requiring functional protein, working aliquots should be prepared and stored at 4°C for up to one week .

What techniques are most effective for studying protein-pigment interactions in this protein?

Studying protein-pigment interactions in Chlorophyll a-b binding protein type 2 member 2 requires specialized techniques:

  • Spectroscopic methods:

    • Absorption spectroscopy to determine pigment composition and stoichiometry

    • Circular dichroism to analyze pigment organization and protein structure

    • Fluorescence emission and excitation spectroscopy to study energy transfer

    • Time-resolved spectroscopy to measure energy transfer kinetics

  • Biochemical approaches:

    • Reconstitution of purified recombinant protein with isolated pigments

    • Differential pigment extraction and quantification

    • Cross-linking studies to stabilize protein-pigment interactions

  • Structural biology techniques:

    • X-ray crystallography for atomic-level resolution (challenging for membrane proteins)

    • Cryo-electron microscopy for visualization of protein-pigment complexes

    • NMR spectroscopy for smaller domains or fragments

  • Molecular dynamics simulations:

    • Computational modeling of pigment binding sites

    • Simulating energy transfer processes

    • Predicting effects of mutations on pigment binding

Research on related LHC proteins has shown that these proteins bind multiple chlorophyll molecules in specific arrangements that facilitate efficient energy transfer . The precise arrangement of these pigments is critical for the protein's function in light harvesting and energy transfer to the photosystems.

How does the structure of Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2 compare to its angiosperm counterparts?

Structural comparison between Pinus sylvestris (gymnosperm) Chlorophyll a-b binding protein type 2 member 2 and its angiosperm counterparts reveals both conservation and differences:

The high degree of structural conservation between gymnosperm and angiosperm LHC proteins indicates that the basic architecture of these proteins was established before the divergence of these lineages more than 300 million years ago .

What experimental approaches would you recommend for analyzing the oligomeric state of this protein in native and recombinant forms?

For analyzing the oligomeric state of Chlorophyll a-b binding protein type 2 member 2, the following experimental approaches are recommended:

  • Blue Native PAGE (BN-PAGE):

    • Particularly useful for membrane protein complexes

    • Can separate different oligomeric states while preserving native interactions

    • When combined with immunoblotting, can identify specific proteins in complexes

    • Choice of detergent is critical: digitonin preserves larger supercomplexes, while β-DM yields smaller complexes

  • Size Exclusion Chromatography (SEC):

    • Separates proteins based on size/hydrodynamic radius

    • Can distinguish between monomeric, trimeric, and higher oligomeric states

    • Can be coupled with multi-angle light scattering (SEC-MALS) for accurate molecular weight determination

    • Use of appropriate detergents is critical for membrane proteins

  • Analytical Ultracentrifugation (AUC):

    • Sedimentation velocity experiments can determine oligomeric distributions

    • Sedimentation equilibrium provides thermodynamic information on self-association

    • Can analyze proteins in detergent micelles

  • Electron Microscopy:

    • Negative staining for initial characterization

    • Cryo-EM for higher resolution structural information

    • Single-particle analysis to determine oligomeric arrangements

    • In membrane crystals, reveals supramolecular organization

  • Cross-linking Mass Spectrometry:

    • Chemical cross-linking stabilizes native interactions

    • Mass spectrometry identifies cross-linked peptides

    • Provides information on protein-protein interfaces

Research on related LHC proteins shows they typically form trimers in vivo. In wild-type plants, these can be homotrimers or heterotrimers with different combinations of Lhcb1, Lhcb2, and Lhcb3 . When studying recombinant proteins, it's important to validate that they form the same oligomeric structures as the native protein.

How do state transitions affect the function of this protein, and what methods can be used to study this process?

State transitions are short-term adaptations that balance excitation energy between photosystems by relocating light-harvesting complexes. Research shows that Lhcb2-type proteins (like Chlorophyll a-b binding protein type 2 member 2) play critical roles in this process .

Impact on protein function:

  • The protein undergoes reversible phosphorylation of threonine residues during state transitions

  • This modification alters its association with photosystems

  • Phosphorylation appears to be a critical step in mediating these transitions

  • Research with Arabidopsis has shown that plants lacking Lhcb2 cannot perform state transitions, despite having normal-appearing complexes

Recommended methodologies to study state transitions:

  • Fluorescence spectroscopy:

    • 77K fluorescence emission spectroscopy to measure relative fluorescence from PSI and PSII

    • Room temperature chlorophyll fluorescence measurements (PAM fluorometry)

    • Time-resolved fluorescence to monitor energy transfer kinetics

  • Biochemical approaches:

    • Blue-native PAGE with immunoblotting to analyze complex formation

    • Phosphoproteomics to identify and quantify phosphorylation sites

    • ³²P-labeling to track phosphorylation events

  • Microscopy techniques:

    • Confocal microscopy with fluorescent protein fusions to track protein movement

    • Electron microscopy to visualize membrane reorganization

    • Freeze-fracture electron microscopy to observe particle distribution changes

  • Functional measurements:

    • Photochemical and non-photochemical quenching analysis

    • P700 oxidation kinetics to assess PSI activity

    • Oxygen evolution measurements

These techniques can help researchers understand the specific role of Chlorophyll a-b binding protein type 2 member 2 in state transitions and how it differs from other LHCII proteins.

What are the challenges and solutions for investigating protein-protein interactions involving this recombinant protein?

Investigating protein-protein interactions involving Chlorophyll a-b binding protein type 2 member 2 presents several challenges due to its membrane-embedded nature and complex assembly into photosynthetic machinery.

Key challenges:

  • Membrane protein solubilization:

    • Maintaining native conformation when extracting from membranes

    • Finding detergents that preserve interactions without disrupting them

  • Complex stability:

    • Preserving weak or transient interactions during analysis

    • Maintaining native oligomeric states and supercomplexes

  • Reconstitution difficulties:

    • Recreating physiologically relevant membrane environments

    • Proper insertion orientation in artificial membranes

  • Tag interference:

    • Affinity tags may affect protein-protein interactions

    • Potential steric hindrance at interaction interfaces

Methodological solutions:

  • Optimized solubilization approaches:

    • Use mild detergents like digitonin or β-DM that preserve interactions

    • Consider detergent-free approaches using styrene-maleic acid copolymer (SMA)

    • Nanodiscs or liposomes to maintain membrane environment

  • Co-immunoprecipitation optimization:

    • Use antibodies against native protein rather than tags where possible

    • Cross-linking prior to solubilization to stabilize interactions

    • Gentle washing procedures to maintain weak interactions

  • Advanced techniques:

    • Surface plasmon resonance (SPR) with immobilized protein

    • Microscale thermophoresis (MST) for measuring interactions in solution

    • FRET-based approaches for detecting interactions in vitro or in vivo

    • Native mass spectrometry for intact complex analysis

  • In vivo approaches:

    • Split-GFP complementation

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET) microscopy

Recent research has shown that LHC proteins form specific associations with photosystem components and with each other in different trimeric configurations . These interaction patterns are crucial for understanding the protein's role in photosynthetic light harvesting and energy distribution.

What evolutionary insights can be gained from comparing Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2 with homologs in other plant species?

Comparative analysis of Chlorophyll a-b binding protein type 2 member 2 across plant species provides valuable evolutionary insights:

  • Evolutionary conservation:

    • The high sequence similarity (~90%) between gymnosperm and angiosperm LHC proteins indicates strong functional constraints

    • This conservation suggests that the core light-harvesting mechanism was established before the gymnosperm-angiosperm divergence (>300 million years ago)

    • The detailed architecture of seed plant light-harvesting antenna can be dated to after the bryophyte-spermatophyte divergence but before the angiosperm-gymnosperm split

  • Gene family expansion:

    • LHC genes occur in multigene families in most plants

    • Differential expansion of these gene families reflects evolutionary adaptation to different light environments

    • In many plants, Lhcb1 and Lhcb2 genes are closely linked on chromosomes, suggesting common evolutionary origin

  • Transit peptide evolution:

    • The transit peptides of the Scots pine preLHC-II show features common to angiosperm transit peptides

    • These signal sequences evolved to ensure proper targeting to chloroplasts and thylakoids

    • Research shows that the transit peptide is not required for intraorganellar routing; the protein contains internal signals for membrane localization

  • Genomic features:

    • CpG and GpC profiles and codon position bias suggest that some corresponding genes lie within CpG islands

    • This indicates conservation of genomic regulatory features across distant plant lineages

Methodologically, researchers can gain these insights through:

  • Phylogenetic analysis of LHC protein sequences across plant lineages

  • Analysis of selective pressure (dN/dS ratios) to identify conserved functional domains

  • Comparative genomics to study gene structure and organization

  • Functional complementation studies across species

How do the structural and functional differences between Lhcb1, Lhcb2, and Lhcb3 proteins inform our understanding of this specific protein?

Research on the functional differences between Lhcb1, Lhcb2 (to which Chlorophyll a-b binding protein type 2 member 2 belongs), and Lhcb3 provides critical context:

  • Distinct functional specialization:

    • Despite high sequence similarity, Lhcb1, Lhcb2, and Lhcb3 have distinct, non-redundant roles

    • Studies in Arabidopsis show that both Lhcb1 and Lhcb2 are necessary for state transitions, but neither alone is sufficient

  • Specific role of Lhcb2 proteins:

    • Phosphorylation of Lhcb2 is a critical step in state transitions

    • Plants lacking Lhcb2 contain thylakoid protein complexes similar to wild-type but cannot perform state transitions

    • Lhcb2 is phosphorylated more rapidly than Lhcb1, suggesting it mediates the first phase of state transitions

    • Lhcb2 is required for the formation of the state transition-specific PSI-LHCII complex

  • Trimerization patterns:

    • In wild-type plants, various combinations of trimers exist:

      • Lhcb1 homotrimers (most abundant)

      • Lhcb1/Lhcb2 heterotrimers

      • (Lhcb1)₂Lhcb3 heterotrimers

    • Lhcb2 can form homotrimers (as seen in plants lacking Lhcb1)

    • Lhcb2/Lhcb3 combinations appear unstable

  • Localization within photosystem supercomplexes:

    • Different trimeric configurations localize to specific positions in photosystem supercomplexes

    • (Lhcb1)₂Lhcb3 trimers typically occupy the M-position in PSII supercomplexes

    • S-positions can be occupied by Lhcb1/Lhcb2 heterotrimers or Lhcb2 homotrimers

This research suggests that Chlorophyll a-b binding protein type 2 member 2 (an Lhcb2-type protein) likely has unique properties related to phosphorylation-dependent mobility and interaction with PSI during state transitions. These specialized functions explain why distinct LHC protein types have been conserved throughout plant evolution despite their high sequence similarity.

What approaches would you recommend for studying the post-translational modifications of this protein and their functional significance?

Post-translational modifications (PTMs), particularly phosphorylation, are critical for regulating the function of Chlorophyll a-b binding protein type 2 member 2. Here are recommended approaches for studying these modifications:

  • Mass spectrometry-based techniques:

    • Phosphoproteomics to identify phosphorylation sites

    • Quantitative proteomics to measure changes in phosphorylation under different conditions

    • Top-down proteomics to analyze intact protein with all modifications

    • Sample preparation strategies:

      • TiO₂ enrichment for phosphopeptides

      • Immunoprecipitation with phospho-specific antibodies

      • IMAC (Immobilized Metal Affinity Chromatography) for phosphopeptide enrichment

  • Site-directed mutagenesis approaches:

    • Create variants with modified PTM sites (e.g., Thr→Ala to prevent phosphorylation)

    • Generate phosphomimetic mutations (e.g., Thr→Asp to mimic constitutive phosphorylation)

    • Express these variants in heterologous systems or transgenic plants

    • Test functional consequences in biochemical and biophysical assays

  • In vitro modification systems:

    • Purify recombinant protein and modify with specific kinases (e.g., STN7)

    • Use phosphatases (e.g., PPH1/TAP38) to dephosphorylate the protein

    • Compare spectroscopic and functional properties before and after modification

    • Reconstitute modified protein into liposomes for functional studies

  • Structural biology approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes

    • X-ray crystallography or cryo-EM of phosphorylated versus non-phosphorylated forms

    • NMR studies of specific domains with and without modifications

  • Functional correlation experiments:

    • State transition measurements with modified protein variants

    • Membrane mobility studies using fluorescence techniques

    • Complex formation analysis using native PAGE

    • Energy transfer measurements using time-resolved fluorescence

Research has shown that phosphorylation of threonine residues in LHC proteins regulates their association with photosystems and is critical for state transitions . These studies could reveal how specific PTMs on Chlorophyll a-b binding protein type 2 member 2 contribute to photosynthetic adaptation under varying light conditions.

How can researchers design experiments to determine the specific role of this protein in state transitions and photosynthetic efficiency?

Designing experiments to determine the specific role of Chlorophyll a-b binding protein type 2 member 2 in state transitions and photosynthetic efficiency requires a multi-faceted approach:

  • Genetic modification approaches:

    • CRISPR/Cas9 gene editing to create specific mutations in the native gene

    • RNAi or antisense suppression to reduce expression levels

    • Complementation of knockout plants with modified protein variants

    • Site-directed mutagenesis of phosphorylation sites or pigment-binding residues

  • Physiological characterization:

    • Compare photosynthetic parameters under different light intensities and qualities

    • Measure state transitions using 77K fluorescence emission spectroscopy

    • Analyze photochemical and non-photochemical quenching

    • Assess growth and fitness under fluctuating light conditions

  • Biochemical and structural characterization:

    • Isolate thylakoid membranes and analyze protein complex composition using BN-PAGE

    • Compare complex formation in state 1 and state 2 conditions

    • Use different detergents to study associations with different complexes:

      • Digitonin to preserve larger supercomplexes

      • β-DM to study smaller complexes

    • Immunoblotting to track phosphorylation status and complex association

  • Advanced imaging and spectroscopy:

    • Confocal microscopy to track protein localization in chloroplasts

    • FRET measurements to study protein-protein interactions

    • Time-resolved fluorescence to measure energy transfer dynamics

    • Electron microscopy to analyze supramolecular organization

  • Comparative studies:

    • Design experiments comparing related proteins (Lhcb1, Lhcb2, Lhcb3) to identify unique functions

    • Compare the protein's behavior across different plant species (gymnosperms vs. angiosperms)

    • Study responses across different environmental conditions (temperature, light intensity, etc.)

Research has shown that Lhcb2 phosphorylation is critical for state transitions and that plants lacking Lhcb2 cannot perform state transitions despite having seemingly normal complexes . This suggests that Chlorophyll a-b binding protein type 2 member 2 likely has specific roles in regulatory phosphorylation and dynamic association with photosystems that cannot be fulfilled by other LHC proteins.

Experimental Design Table for Key Applications

Research ApplicationRecommended MethodsKey ConsiderationsExpected Outcomes
Protein Expression & PurificationE. coli expression with His-tag; IMAC purification Use mild detergents; avoid repeated freeze-thaw cyclesPurified protein with >85% purity; yield typically 1-5 mg/L culture
Structure DeterminationX-ray crystallography; Cryo-EM; Homology modeling Membrane protein crystallization is challenging; consider lipid cubic phase methods3D structure showing transmembrane helices and pigment binding sites
Pigment Binding StudiesAbsorption spectroscopy; Fluorescence; CD spectroscopyReconstitute with purified pigments; maintain sample in dark when possibleBinding stoichiometry (8 Chl-a, 6 Chl-b) and affinity constants
State Transition Analysis77K fluorescence; BN-PAGE; Phosphorylation assays Compare state 1 (dark/far-red) vs. state 2 (PSII light) conditionsDifferential complex formation; phosphorylation patterns; energy redistribution
Oligomerization StudiesBN-PAGE; SEC-MALS; Analytical ultracentrifugationChoice of detergent critical; digitonin preserves larger complexes Determination of native oligomeric state (likely trimeric) and binding partners
Protein-Protein InteractionsCo-immunoprecipitation; Crosslinking-MS; FRETPreserve membrane environment; consider mild crosslinkingIdentification of interaction partners and binding interfaces
Phosphorylation AnalysisPhosphoproteomics; Mutagenesis; In vitro kinase assaysUse STN7 kinase and PPH1/TAP38 phosphatase Identification of specific phosphorylation sites and their functional effects

This table provides a comprehensive overview of experimental approaches for studying different aspects of the Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2, focusing on methodology and expected outcomes rather than commercial considerations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.